SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015730723.1.68032 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015730723.1.68032
Domain Number 1 Region: 56-519
Classification Level Classification E-value
Superfamily Sema domain 1.83e-123
Family Sema domain 0.0000576
Further Details:      
 
Domain Number 2 Region: 1698-1825,2014-2200
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.9e-45
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 1165-1259
Classification Level Classification E-value
Superfamily E set domains 8.66e-17
Family Other IPT/TIG domains 0.0082
Further Details:      
 
Domain Number 4 Region: 1257-1347
Classification Level Classification E-value
Superfamily E set domains 0.000000000000306
Family Other IPT/TIG domains 0.05
Further Details:      
 
Domain Number 5 Region: 522-574
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000419
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 1347-1391,1420-1472
Classification Level Classification E-value
Superfamily E set domains 0.0000000868
Family E-set domains of sugar-utilizing enzymes 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015730723.1.68032
Sequence length 2233
Comment PREDICTED: plexin-B1 isoform X1 [Coturnix japonica]; AA=GCF_001577835.1; RF=representative genome; TAX=93934; STAX=93934; NAME=Coturnix japonica; AL=Chromosome; RT=Major
Sequence
MGEDLGFPERQREEPVSPVHLVAVRLLRVFTMPLGTILLPILCFLGVAIPRGLQYVTFSR
NATRFLHLSMDSESGTIYLGATNFLFQLTSDLLMENMVQTGPVLDSKDCLPPVSKLECPQ
AHHTDNHNKLLLVNSVQKELIVCGSVHQGICEKRSLTSIDHVLFRPESPGDTQYVAANDP
NITTVGLVAYSKDEVPLLFVGRGYTSRGVGGGIPPITTRNLRAHGSDVQATDSHSIFSYE
ETAKLAVGRLSEYNHHFIKSFTYRSSVYFLFYRRDLKSQSREYKTYISRICLDDSHYYSY
VELPLLCQGKTNTYSLLQAAYVTQPGKDLAQGQLDTDGEVLFATFSAWQASSGKLSEESA
LCIYAMEEVDRLTNWTRDVCYMRDGKSEDGAEVAYIEYDVSSNCVQLPADTLYAYPCGSD
HTPSPMASRVPLEAAPLLETTESRLTAVAVNVEDGHTIAFLGDSKGRLHKVYLGAMGDAH
IYASLAIQLNSVVSGDLLFDQLQEHLFVMTQSMVLKVPILECSLYADCESCLALKDPYCG
WCVLQGRCSRRSECLRSGLSEQWLWSFNSTQQCLSIQSLTPANISREEKRNIFLAISDLP
SLREEEFYSCYFQDYESPAVLTESGIMCPSPDPNQTPALPAGADHVTIKLVVRFHDIFIA
SVDFSFYDCAAVALLWKSAPCQKCVSSPWGCNWCVQQHLCTHKAACEEGTIIYNERAQIP
TSSVFLSSAAPLTKSSTVAPVVTIKPITPPVHAVSNTVPPTEPNHITFSAASDSMTEPTE
IISNPYSTLSAEAASLQAVTEHPLPPPADKPAVTLPGTASPAASILTSPGKNMDRAALPT
IGPSAAHEPWHTEPPTTVAATPLFTSSPAVTPSPHVTSLRLPLSSFPTAEALTSAIPSPQ
TPGQMPEDPSASNDSPAMLGTEIPASEPPPSASQDSVLGEDAELQDTEDWMDLLQAENDT
SPFSASTLLSGDGDSSERDVPDLPRILHPDLDYQYDAPGFWENEELSWGPGACPCVQGIQ
GSSLFPVNVTRKITLLGKNFHLYRDQRWDYECVLNLEGRTMVMDAYVEGDEANQSLCYIT
CQLNQYSYTAPQLEFNAVVFVQRRQHLRVDSAADLHVTFYNCSVGHTDCSRCQTADSKYN
CVWCGGDKPSCIFRGSCKEEIEDLCPAPLIHSVYPLSGPVEGGTRITITGSNLGQKHQDI
AETVTVAGIPCAVDAQEYEISSSIVCVTGGSWAERVGHVVVEVPGGGRGVSEHIFTYQNP
ELRSIVPTQGPKAGGTCLTLLGSKLLTGHPNEISVLLGDLPCHILSEMTEDQLACQTSPS
NVSTELPVTIKYGEQERRLEGSLFRYTLDPNITFAEPPKSFLSGGRVLRVHGFNLDVVQS
PKIRVTVSPSERRRRGLGRWRRIIPDTECPKDALCSIQQFEEPCLVNSSYLILCKTPAIN
LLLRSVHIKLEFILDNLSFDFNSLHPIPFSYEVNPILKPLNAEDPAKPYRHKPGSVISVE
GENLDLAISKDEVMAMIGEGICVVKTLTRNHLYCEPPSEQPAPRHRTKREGTDLLPEFTV
QMGNLNFLLGRVQYDTESQLTFPLEAQIGLGVGASFVALIVLVIVFIYRRKSKQALRDYK
KVQIQLENLETSVRDRCKKEFTDLMTEMMDLTSDLVGTGIPFLDYKSYAERIFFPGHRES
PLQRDLDIPECRRQTVEQGLVQLSNLLNSKLFLTKFIHTLEIQRTFSPRDRAYVASLLTV
SLHGKLEYFTDILKTLLNDLVEQYVAKNPKLMLRRTETVVEKLLTNWMSICLYAFVRDSV
GEPLYMLFRGIKHQVDKGPVDWVTGKAKYTLNDNRLLREDLEYRTLTLNALTQAGVAAGG
AEDSQGISAKVLDCDTITQVKEKILDQIYKGMPYCHRPDPDTLDLEWRSGLAGHLILSDE
DVTSVVQGTWKRLNTLQHYKVPDGATVALVPRLTKHIHRENQDYIPGEKTPMLEDADEGG
IKLWHLVKPTEEPELPKHRRGSLRDRERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILS
TSRPVPLAVKYFFDLLDEQALHYGIADPETIHIWKTNSLPLRFWINIIKNPQFVFDVQTS
DNVDAVLLVIAQTFMDSCTIADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTISA
SDQEMNSALAELSRNYSGDLNSLVALHELYKYINKYYDQIITALEEDPTAQKMQLGYRLQ
QIAAAVENKVTDL
Download sequence
Identical sequences XP_015730722.1.68032 XP_015730723.1.68032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]