SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015745248.1.37977 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015745248.1.37977
Domain Number 1 Region: 257-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000154
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 894-946
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000916
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 392-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000393
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 730-776
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000636
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 5 Region: 951-1000
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000145
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 861-902
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000045
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 7 Region: 768-826
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000749
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015745248.1.37977
Sequence length 1232
Comment PREDICTED: zinc finger protein ZFAT [Python bivittatus]; AA=GCF_000186305.1; RF=representative genome; TAX=176946; STAX=176946; NAME=Python bivittatus; AL=Scaffold; RT=Major
Sequence
MCKLCNLFSPNQSELLSHVSEKHSEDGTKVDEIIILLRPLTTPTNLNKNGEELLVVKRKR
GRPKGSTKKCYADEELAENSTCAPTEGAQPGPEEGGELVEVPADNLECRKCNRKFSNSRQ
LRKHICIIVKHEDLEEEGDSGNDSDVDLDRREDEREKPPKRQRVQKTEKSLFSKEADQGS
GAKNPIISVVLTAHEAIPGATKIVPVEAASPKIEQPINSETSVSDSSQRRGYQEYAIQQT
PYEQPMKSSRLGATQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCSFCSYASAIKA
NLNVHLRKHTGEKFSCDYCPFTCLSKGHLKVHVERVHKKIKQHCRFCKKKYSDVKNLIKH
IKEAHDLQDKKVKNVFDELRLMTREGKRQLLYDCQICERKFKNELDRDRHMLVHGDERPF
ACELCGHGATKYQALELHVRKHPFVYICSECSKKFVSSIRLRSHIKDAHGELPETSVFNN
SINQSFCLLEPGGDIQQEALGEELSQTAAELSLLNSKALCIVKSVCMGEVNTIEGNNNNN
PADSLEMSPPPLLDSESPPAANATDPVCEPLTELLSPHASPVCTSDSFLQKNASPNSDGE
KIHSIKEELSLNCSANVQCEVEQLLEDGSSSLNQNCQGPQSVPDTEEKSQTICLNHQVVK
KSTPEKTGSSNSLPILESSTVSDQKPESCPQPSEDQTGTAAFMQILDSLQKQQMSTALCE
KIRKVYGDLECEYCGKLFWYQVHYDMHVRTHTREHLHYCSQCSYSSITKNCLKRHVIQKH
SNILLKCPTEDCDYSTPDKYKLQAHLKVHSELDKKNYSCPVCEKSFSEDRLIKAHIKTNH
PEVSMHTISKIVGRRVQLKGLIGKRAVKCPYCNFYFMKNGSDLQRHIWAHEGIKPFKCSL
CEYATRSKSNLKAHMNRHSTEKTHLCDRCGKKFKSKGTLKSHKLLHTADGKQFKCTVCDY
TAAQKPQLLRHMEQHASFKPFRCAHCHYSCNISGSLKRHYNRKHPSEEYVNAGSGEFAAE
ALLQQGGIKCPVCNFVYGTKWEFNRHLKNKHGLKLMEYDGEAKWEQTTEISEETSTQYLH
ITEAEDLQGTQAAVAALQDLRYTSENGGRLDATTAVNILQQIIELGSEPHDGAAVASVVA
MAPGTVTVVKQVTEEEQSANHTVMIQETLQQASVELAEQHHLVVSSDDVEGIGTVTVYTQ
GGEASELIVYVQEAMQPVEEQAEEQEQSGQKI
Download sequence
Identical sequences XP_015745248.1.37977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]