SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015785250.1.93521 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015785250.1.93521
Domain Number 1 Region: 40-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 88-120
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000353
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015785250.1.93521
Sequence length 229
Comment PREDICTED: low-density lipoprotein receptor-related protein 5-like [Tetranychus urticae]; AA=GCF_000239435.1; RF=representative genome; TAX=32264; STAX=32264; NAME=Tetranychus urticae; strain=London; AL=Scaffold; RT=Major
Sequence
MVLLLVIICTISIAISNGSIINNRNQLLKGDFTDKVNNQPVCLPNQFHCFNGPCINQEYR
CNGLIECPQGDDEQSCPPLPSPKEDSCAYQCQESKRCIPRSLLCDGKIQCLLADDEFHCN
FAIGVTGQQSGKSSSVSQLNGADPPFNQAIAMSDTENQSNVHSINSFDPPKDGSDYVFVN
FGPIINGDKNVNGDGNKINSGNGNGNGNGNGNGRNNSDGNRSYNNNTII
Download sequence
Identical sequences T1KAV2
tetur08g01870 XP_015785250.1.93521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]