SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015823896.1.37898 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015823896.1.37898
Domain Number 1 Region: 29-513
Classification Level Classification E-value
Superfamily Sema domain 1.57e-101
Family Sema domain 0.00074
Further Details:      
 
Domain Number 2 Region: 1387-1510,1676-1860
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-32
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 1041-1121
Classification Level Classification E-value
Superfamily E set domains 0.000000000000255
Family E-set domains of sugar-utilizing enzymes 0.026
Further Details:      
 
Domain Number 4 Region: 858-949
Classification Level Classification E-value
Superfamily E set domains 0.000000000000356
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 5 Region: 511-558
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000244
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 949-1039
Classification Level Classification E-value
Superfamily E set domains 0.000000000267
Family Other IPT/TIG domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015823896.1.37898
Sequence length 1900
Comment PREDICTED: plexin-D1 [Nothobranchius furzeri]; AA=GCF_001465895.1; RF=representative genome; TAX=105023; STAX=105023; NAME=Nothobranchius furzeri; strain=GRZ; AL=Chromosome; RT=Major
Sequence
MPPSMEIAVLLLGVLALETRRSASALHIQQAFTSPNHTNNFVVDPVSRKVYLATVNTVYQ
LNGTLSLEVEQRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLELDREQGVVVVCGS
VYQGFCELRKMGNVSEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFRSHGGNTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNIKDLSRLFTYDINPSEDNVFKIKQ
EVKPKNKLNFVHAFIQKTYSYIAFNNDAKMGHKESQPNSMLSRICLDTESRRKSSGPDSR
KLTESYIQMPLQCGSNGDIYNRLLSVYPAEIQAGPGRGPESYLFGVFSKADRESALCAFR
FRDIEEEIRQARRNCSNSPSSDVQVLDSVIQGSGAACIQKGNLVLQPEQLDCGAAHLQHP
LALQRPLRASPLYENQGLTSVSVDSVHNHTVVFLGTSNGRLCKLTLLLNMTLAYQRTLKL
PASEAVHHIMTFDPNDSNFLYVMTSHHMLRVKVAECDQWKSCSSCLGAGDAHCGWCTLEN
RCTIQKECARGLLARSWITLGEGPQQCPSITLTPPEISISANIKDVGILINGSVPDLIGS
RVECEYRPGISTAATLHLDYGPAQIQTCPLLPRENYRPIPPRTDHLTVSVAIKVNGTSVV
SGSFIIYDCERTGAIHPKTSCMSCLSTRWKCYWDQENHLCLSSKDETKENLLESAASCPS
LIASDVPPSPSGAAQDFTLSLSNIQEREDLECDFGTDQRYEATWLDNSTVKCSGVVLSTA
QRSQVYHLNLRRRGYFTSQPEDIFLDSPQPMKVEVYNCGVGSSDCSQCWGREDQGHLCGW
CENSCRPRDDCQPITDPCPAPEIHKISPLRGPTEGGTLLTVQGRNLGQRPAGVKIFIGDV
PCDLLPQHYTVSVELVCRTGRSERDSVEFVRVDVNQSGTGASKEKFSYLVPKLLSMEPEK
GSRAGGTRVTLRGEHLDIGSQVRVKVNDTLECSITEKTDEMIECVMPPALQALTESVAVC
VEFEDHPCKNSELSTIYTYEKNPTISSIHPKKSFLSGGRTITVSGRGFDLVQSVTMQVRE
IGQMQDCLVLSSSTIICRSPASTQSQETSVQFVLNGVLYTGDGPSSSDNKQEEEDGDLHK
GHFLLEYVEDPQFFTANKEKLIKHHSGEPLTLIINKVPSDLELMPEEYSVMIGSYPCNIS
FHNDQLFHCTINGLLSSSESELPVTVQVGNFHHTIAKVQLGGSELAIVVSIVVCCVLLLL
CTVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQG
IPFLEYKQFVTRTFFPKMCSDYEKSLVQPTYENDSLGPRVVPETHPLLQDWQATNTTRPN
IEEGITLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKD
LLVDLIDASASRNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQI
NKGSIDAITGKARYTLNEEWLLRENVEAKPQNINVSFQGCGMDSLSVRVMNTDTICQVKE
KIIEAFYKNLPFSQWPRAEDVDLEWFDSGSNSRLLQDLDNSSVMEDGRKKLNTVFHYQIP
EGASLAMSMKDIKGNTLERVKDLDTEKYVHLVLPHDELIETKKAHRHSHRKKVLPEIYLT
RLLSTKGTLQKFLDDLFQAILCIPPERPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTN
SLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYA
KEIPEYKKRVQCYYKQIQDMSPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYR
NQVVNALETNPTARRTQLHHRFEQVIALMEDNIYECCSEA
Download sequence
Identical sequences A0A1A8AP93
XP_015823896.1.37898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]