SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015826113.1.37898 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015826113.1.37898
Domain Number 1 Region: 458-591
Classification Level Classification E-value
Superfamily TIMP-like 4.47e-26
Family Netrin-like domain (NTR/C345C module) 0.021
Further Details:      
 
Domain Number 2 Region: 233-328
Classification Level Classification E-value
Superfamily Immunoglobulin 5.11e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 411-464
Classification Level Classification E-value
Superfamily BPTI-like 1.7e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0038
Further Details:      
 
Domain Number 4 Region: 346-405
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000199
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.013
Further Details:      
 
Domain Number 5 Region: 150-200
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000568
Family Ovomucoid domain III-like 0.031
Further Details:      
 
Domain Number 6 Region: 57-104
Classification Level Classification E-value
Superfamily Elafin-like 0.000000876
Family Elafin-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015826113.1.37898
Sequence length 591
Comment PREDICTED: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 [Nothobranchius furzeri]; AA=GCF_001465895.1; RF=representative genome; TAX=105023; STAX=105023; NAME=Nothobranchius furzeri; strain=GRZ; AL=Chromosome; RT=Major
Sequence
MCEILLRLLDEKRSTDLIWQNAPGANKPLSGWRHVGLLVLLMCDFLEFSLCATVAGSRVE
HEGFCPNKLNTNLWVDAQSTCERECNIDEDCADFEKCCTNVCGFNSCVAARFSDGSPAQP
EGKWGGVGDVAPTSTATCEGFICSQQGATCDIWDGQPVCKCRDRCEKEPNFTCASDGLTY
FNRCYMDAEACIRGVTLTVIPCRFYLAGPQTSPIPQDTTVNPTPTSSQEDPLPPTLYSNP
HHQSIYVGGTVSFHCDVVGVPRPDVTWEKQGDRRERLVMRPDQMYGNVVITNIGQLVVYN
AQVWDTGIYTCIARNSVGVLRADYPLSVIRRADDDFSEDPEMPMGRPFSPADCLAEVDLR
VCSGERHVDWFYDGKLGACVTFSNGGCDDSRNRFETYEECKASCQREGMGICSLPAVQGP
CKNWEARWAWNSLMKQCQAFAYGGCHGNDNNFRTKKDCDANCPQPKRKPCRACRMRGKMM
PSLCRSDFAIVGRLTELVEDLDSGLARFSLEEVLRDEKMGLTFFSTKHLEVTITKIDWSC
PCPNITIEENPLLVMGMVQDGMAILQSDSYVKAITERRLKKLRDALNKKTC
Download sequence
Identical sequences XP_015826113.1.37898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]