SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015829615.1.37898 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015829615.1.37898
Domain Number 1 Region: 488-654
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.1e-72
Family A middle domain of Talin 1 0.0000000882
Further Details:      
 
Domain Number 2 Region: 752-888
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.1e-53
Family I/LWEQ domain 0.00000124
Further Details:      
 
Domain Number 3 Region: 2293-2482
Classification Level Classification E-value
Superfamily I/LWEQ domain 8.34e-52
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 659-782
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.22e-51
Family I/LWEQ domain 0.00000234
Further Details:      
 
Domain Number 5 Region: 1840-1971
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.96e-41
Family VBS domain 0.00000342
Further Details:      
 
Domain Number 6 Region: 1225-1360
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.33e-37
Family VBS domain 0.022
Further Details:      
 
Domain Number 7 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-35
Family Second domain of FERM 0.00000089
Further Details:      
 
Domain Number 8 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-25
Family Third domain of FERM 0.0000096
Further Details:      
 
Domain Number 9 Region: 1074-1206
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.18e-21
Family VBS domain 0.035
Further Details:      
 
Domain Number 10 Region: 1467-1553
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000968
Family I/LWEQ domain 0.0074
Further Details:      
 
Domain Number 11 Region: 2006-2130
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000753
Family VBS domain 0.012
Further Details:      
 
Domain Number 12 Region: 1685-1811
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000204
Family alpha-catenin/vinculin 0.09
Further Details:      
 
Domain Number 13 Region: 920-982
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000883
Family I/LWEQ domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015829615.1.37898
Sequence length 2541
Comment PREDICTED: talin-1 [Nothobranchius furzeri]; AA=GCF_001465895.1; RF=representative genome; TAX=105023; STAX=105023; NAME=Nothobranchius furzeri; strain=GRZ; AL=Chromosome; RT=Major
Sequence
MVALSLKIDVGNVVKTMQFEPSTMIYDACRIIRERVPEAQLGQPNDYGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTLEYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIG
ITNYDEYSLVRDIGEEKKEENTGTLKRDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEETEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
YQCQIQFGDHNESKHKPGFLDLKEFLPKEYIKNKGERKIFQAHKNYQNMTEIEAKVSYVK
LARSLQTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVVQQQFNKMGRVETGSVALPAIMRSGAGGPEGFHMGSMPQAKQHITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQASLDDFDTLPPLGTDAASQAWRKNKMDESK
HEIHSQVDAITAGTASMVNLTAGDPAETDYTAVGCAVTTISSNLTEMSKGVKLLAALMED
EGANGQQLLSAAKNLACAVSDMLKTAQPANTEPRQNLLQAAGNVGQASGELLSHIGETDT
DPQFQDMLMHLAKAVANAAAALVLKAKNVAQKTEDSAQQNRVIAAATQCALSTSQLVACT
RVVAPTISSPVCQEQLIEAGKLVAKSVEGCVEASHRATGDEGLLKQVGQAATGVTQALNE
LLQHIKQYASGGHPIGRHGEATDRILDVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KMDAEGESDLENSRKLLSAAKLLADATARMVEAAKGAAANPDSEEQQQKLREAAEGLRMA
TNAAAQNAIKKRLINKLENAAKQAAAAATQTIAAAQHAASSNKNQAAQQQLVQSCKVVAD
QIPQLVQGVRGSQAQPDSPSAQLALIGASQNFMQPGAKMVTACKATVPTISDQASAMQLS
QCAKNLASALAELRTAAQKAQDACGQLEIDNALNMVRDLEKDIQEAKAAAREGKLQPLPG
DTLGKCSQDLGTSTKAVTSGIAQLLSETTQGDENYIGISARDVAQTLKSLASAARGVAAT
TDDPAARGAVLDCAGDVLDKSANLIEETKRAIVKPGDAESQQRLAQVAKAVSQALNRCVN
SLPGQRDVDNAIRTVGESSKSLLAESFPSSGRSFQELQAQLNEVAAELNQSANEVVQASR
GTTQDLSRATSKFGQDFSQFLKAGVDMAGTSQSKEDQTQVVSNLKTISMSSSKLLLAAKA
LSTDPSSPNLKNQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELQSVKGMLENPT
EAVNDLSFFECIDSVMENSKVLGESMAGISHNAKNSNLPEFGDSVSGGSKALCGLTEAAA
QAAYLVGVSDPNSSAGQKGLVDPTQFARANQAIQMACQNLVDPACTQSQVLSAATIVAKH
TSALCNACRLASSKTSNPIAKRQFVQSAKEVANTTANLVKSIKALDGAFNQENREKCRSA
TGPLIEAVDNLTAFASNPEFASIPAQISPEGRAAMEPILAAAQTMLESSTGLIQTARSLA
VNPKDPPKWSVLAGHSRTVSDSIKKLITNMREKAPGQRECDDAIEVLNGCIRKVDHASLA
AISQQLTPREDISMETLHEQMAASVHEISNLIDPVAIAARSEASQLGHKVSQMASYFEPL
IMAAIDTASKILTSQQQMAVLDQTKTLAESALQMLYTAKEAGGNPKAAHMQDALEESVQM
MKEAVDDLGATLAEAAGAAGAVGGMVDSINDAINKMEDTTVQEPDGTFVDYQTTMVKTAK
AIAVTVQEMVTKSNTNPDDLGGLANQLTNNFGNLANEAKYAALTAENDDIGSHIKKQVGE
LGFSCTGLVTKAGALQCSPNDSFTKKELIESARRVSEKVSHVLASLQAGNRGTQACITAA
SAVSGIIADLDTTIMFATAGTLNRENAETFADHRECILKTAKALVEDTKLLVSGAGASQE
KLAQAAQSSVSTITKLADVVKLGAASLGSEDPETQVVLINAVKDVAKALGNLISATKAAA
GKPHDDPSMLQLKSSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATIEHIKQELTVFCS
SDPPPKTTTPEEFIRMTKGITVATAKAVAAGNSCRQEDIIATANLSRRAIADMLHSCKEA
AHHQDVGMEVQMRALRYGKECATGYLGLLEHVLVIIQKPTHDLKQQLASYSKRVAGSVTE
LIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLRPRTKPKEADESLNFE
EQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAVDDGQWSQGLISAARMVAA
ATNNLCEAANSAVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSQTMKRLQAAGNA
VKRASDNLVKAAQKAAFDAQDDHAVVVKSKMVGGIAQIIAAQEEMLRKEKELEEARKKLA
MIRQQQYKFLPSELREDGQEQ
Download sequence
Identical sequences A0A1A7ZUL9
XP_015829615.1.37898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]