SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015834167.1.52716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015834167.1.52716
Domain Number 1 Region: 3-49
Classification Level Classification E-value
Superfamily F-box domain 0.0000000124
Family F-box domain 0.0039
Further Details:      
 
Domain Number 2 Region: 67-352
Classification Level Classification E-value
Superfamily RNI-like 0.000000722
Family Cyclin A/CDK2-associated p19, Skp2 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015834167.1.52716
Sequence length 422
Comment PREDICTED: F-box/LRR-repeat protein 3 [Tribolium castaneum]; AA=GCF_000002335.3; RF=representative genome; TAX=7070; STAX=7070; NAME=Tribolium castaneum; strain=Georgia GA2; AL=Chromosome; RT=Major
Sequence
MGDWENLPVELLAHLYSYLSRRDRLSCSLVCENWKSGLDHVILWKTVIVHVDSDLMEPST
VILLRDYCKYIKNLEFGWAVPHRNNKWAQVRYKELTKRAVRFFLVLYDNYIQIHSLRIFN
WFDFMSFQKVTYHLSRFLKNQVSLKKIIFDNINMHSANYMKVLTSCLGSRGTITHLDIRS
CYYCQSSFDAIYFRSCIEQLTYLKSFKLDYFILSCRLIDSILTSKNRSLEHLEIVLKETS
WHDHVIDDEQWCLLCSACPNLKVTLIIRNVYHYGELRLYLKQSIPIVSLSIILPRVMDRG
GRWNFGKTLNLLVSNYHRTLETIDLHIKNDGEVVDDVLLRLIHRCSKLKSFLFNGYLENP
QLLKSSFSDITFFCMTPNSLPDKHLVFNKVIRDDVTELRHKRVQFTLIKRSPKSICSLLV
LN
Download sequence
Identical sequences D6WI14
TC002468 XP_015834167.1.52716 7070.XP_968278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]