SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015835342.1.52716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015835342.1.52716
Domain Number 1 Region: 605-821
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-54
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 80-200
Classification Level Classification E-value
Superfamily BRCT domain 1.89e-19
Family DNA ligase 0.033
Further Details:      
 
Domain Number 3 Region: 171-271
Classification Level Classification E-value
Superfamily BRCT domain 1.89e-16
Family DNA topoisomerase II binding protein 1, TopBP1 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015835342.1.52716
Sequence length 1039
Comment PREDICTED: protein ECT2 isoform X2 [Tribolium castaneum]; AA=GCF_000002335.3; RF=representative genome; TAX=7070; STAX=7070; NAME=Tribolium castaneum; strain=Georgia GA2; AL=Chromosome; RT=Major
Sequence
MDARIQPQSSICSDSNWEEPAGNDVAPLKSNRRICLVGGLTTDTALRTVAESFRVPVVTS
KDGEDCAQDDSFSTVFILESFEGDVFNCLYKQKQSLMGPLALQQLANKNEPLPDNTRPLF
NLAMTGVVVCFTGFRNKSDLATLVPLIHHMGGSIRKNISQKVTHLIANICNGEKYRYAAV
FRVPVMNQDWVYASWKKRHDINFSATVDAFVAEFKLKPFHGAKVCFVGFAEDEKKHMTDI
LLSNGGTVTSLEDPQCSHVVMERSEVCTLEAASAPLSPTEPVNPSIPDPPEHLNYNGFLE
TLHEKSRDSCIDDSNLNTSEFSSGSRKRKIPSTESSVVKTKRRKDKCASERKSKVSGIFK
TPLNYLSNRRRTIDTFSFNETLNQSVVSSSGVFNVDTVENLSVLNQSQFTPQSSNKQKKN
LFARTFSSSKFNRSKLKKCNLNATRLSFSEASDVDGNEPLNASCFPNISLNPVPHSELRS
DCSKDARGPSVPTISVVDESSVAERPETTSPKVFLVKAEWFWTSVQKEICLDEKDYLYDD
YVEQTFSPTRRESHQATPSSASRRKRKRLHEAVLSLTHQQSPVSGSFLDCTASPDKALTD
GTEPSIDTPRKGLTARQQVFLELVQTESNYVDILHTIMTMFKKHLEEMPEEEALLNNTEL
NLIFGKVPAIYETHMKMRDELRCFASTWSEDHTIGSIIVKYSKDLLKAYPPYINYFEEMK
EVLTKCDQNKPRFHAFLKACQTKPECGRQSLQELMIRPVQRLGSICLLLANLLKHTPKSN
PDHAELQRALDGLKEGMDLINEDKRKAEAQVALFNMFNDIDNCPPDIVCSHRKFIAKAEV
IQVSTTEGLSSKGNSLVLFLFSDLVEVCKKKSKTFNNAKSPTGSVNSLQRPKLYKHVKLL
PLNTIKKVIDIKETEQCQKVFCFVCRNNDELKERVYSFAMPDEDADKAGFLKTLTKQMAN
NACTPDADKFLAYLESHQLDIDTSDMNKGTLNKAFKFASRTKLKVGRAFSFNKTPSKLKR
AVSSMMSPFGSSTDYLHTT
Download sequence
Identical sequences XP_015835342.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]