SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015836065.1.52716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015836065.1.52716
Domain Number 1 Region: 187-450
Classification Level Classification E-value
Superfamily RNI-like 2.98e-40
Family 28-residue LRR 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015836065.1.52716
Sequence length 499
Comment PREDICTED: T-complex-associated testis-expressed protein 1 isoform X1 [Tribolium castaneum]; AA=GCF_000002335.3; RF=representative genome; TAX=7070; STAX=7070; NAME=Tribolium castaneum; strain=Georgia GA2; AL=Chromosome; RT=Major
Sequence
MRIPVTVNPNTLKTYNCYNERRIEKNTLRSDNLSSWDQAIPKTLQELCLESIAKNWQEKP
ILDEIIVTIDRCFLLNILPTDLPLALTVPKIHDDIYWKRCYLQRWPKVIPENVSLDVQIN
EIVKVSNSRKSSEESERSRKSSAEAGFKRTWKECFLEIHICEYLEKLKPEKYDAEKIKEL
ADLCTDYVKILDIRELQCSENSPNRIPLNAITSGLGNLTELSICFKQTYVGEKFTWDTVR
TSLQDIKLLAKGLEKCKLTVFRLRNSDIDDEKAVVILKSLLKHELETLDFSHCRIRDYGA
VAISKFCLENSVTNLILTNNRIGAKGIEAISYAICSPTCNLKSLDLKLNPISQRGVEILM
KPLTLSARKLKILHLNACGVGPISALGEMIEHNSHLEHLDLSNNPFGEEMGKIIMRGLRY
NTTLKKLDVRMCKLNSADEFEILQRINKNRIAMKRPRTARKPIIIEPQYKFEISDELLSE
MENVFQSNKSDETTNELIE
Download sequence
Identical sequences D6WNC5
TC014646 XP_008194193.2.52716 XP_015836065.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]