SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015843688.1.50099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015843688.1.50099
Domain Number 1 Region: 426-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-24
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 258-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-24
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 593-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 538-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.74e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 370-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 481-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 33-92
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.29e-21
Family KRAB domain (Kruppel-associated box) 0.00018
Further Details:      
 
Domain Number 8 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 9 Region: 148-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 639-691
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-17
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 11 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.46e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 12 Region: 96-144
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000335
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015843688.1.50099
Sequence length 692
Comment PREDICTED: zinc finger protein 431-like isoform X3 [Peromyscus maniculatus bairdii]; AA=GCF_000500345.1; RF=representative genome; TAX=230844; STAX=10042; NAME=Peromyscus maniculatus bairdii; AL=Scaffold; RT=Major
Sequence
MCGALQFYDYAVKEVYTCNVVNTMLSVVHMYGIFQNAVTYDDVHIDFTWAEWTLLDPSQK
NLYKDVMLETYRNLTTIGYSWEDHDIEDHCKSSRRHERQERIHIGEQSSEHTECVKAFAH
HYTLHRHERTYTGVMPSEYNQCGKALAYHSNLERHKKAQTGEKPYECDQCGKCFAYYRNL
QIHKITHNGEKSYACNQGGKAFALQRRLQIHKRTHAGEKPNERTWFGKGFSQLSVLQVYK
RIHTGEKPYKCHQCGKDFVCQSHLRIHKRTHTGEKPYECTQCGNAFALRSNLQRHKRTHT
GEKPYECNQCGKAFERHSSLQMHKIIHTGEKPYACNQCGKAYTRHSGLQMHKRTHIGEKP
CECNQCGKGFNYHSSLRIHKRTHTGEKPYECNWCGKGFSQLNHLQVHERTHSGEKPYECN
QCGKDFVCQSHLRIHKRTHTGEKPYECTQCGNAFALRSNLQRHKRTHTGEKPYECNQCGK
AFERHSSLQMHKIIHTGEKPYACNQCGKAYTRHSGLQMHKRTHTGEKPCECNQCGKGFNY
HSSLRIHKRTHTGEKPYECNWCGKGFSQLNHLQVHERTHSGEKPYECNQCGKAFVCQSHL
QIHKRIHTGEKPYECTQCGKNFAYQSHLQRHTRTHTGEKPYACNQCGKAFACYSGLQMHK
IIHTGKKPYECNQCSKVFVHYSSLQRHKIIHT
Download sequence
Identical sequences XP_015843688.1.50099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]