SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015845530.1.50099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015845530.1.50099
Domain Number 1 Region: 268-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.59e-26
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 548-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 492-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.89e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 212-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 380-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 6 Region: 324-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 7 Region: 605-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.19e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 9-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 9 Region: 436-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-21
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 10 Region: 646-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000209
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 157-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000177
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 101-157
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000502
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015845530.1.50099
Sequence length 728
Comment PREDICTED: zinc finger protein 420-like isoform X2 [Peromyscus maniculatus bairdii]; AA=GCF_000500345.1; RF=representative genome; TAX=230844; STAX=10042; NAME=Peromyscus maniculatus bairdii; AL=Scaffold; RT=Major
Sequence
MNTSSVNASQSLLTFRDVAVDFSQEEWECLDCAQRALYMDVMLENYNNLVFVGENQRVHI
GNKEQKNTDLDKSFDSQHKLTLEQIKSRMKLHQSWKSGNCFKTDSILGRHQRAYTRQKPY
KCTKCSKYFTHFSQLKVHCKFNCGEKSYKCTDCPKCFYQTSEFKRHCRIHSGETICNYSE
CDKSFISTSSLRMHQKICPGEKPYGYGECDKSFIWKLNLGSHQRNHTGEKPYKCSECNKS
FTDRGGLNTHLRMHTGEKPYKCTECEKSFTTSSHLRTHQRIHTGEKPYKCSECDKSFVSS
SDLRKHQIIHTGEKPYKCSECGKSFNHRGTLTSHQRMHTGEKPYKCIGCDKSFTTASQFR
SHKRIHTGEKPYKCSECEKSFTCGSYLRLHQIIHTGETPFKCSECDKSFTQKRSLRIHQR
IHTGEKPYKCGECVKSFVSCSELRRHEKIHSGEKPYKCIGCDKSFSTDSQFRSHQRLHTG
EKPYKCTECDKSFMQKNSLRIHQRMHTGESPYKCTVCDRSYCHSSSLIAHQRIHTGEKPY
KCSECDKSFISSSELRIHQRLHTGEKPHKCTECDKAFSRKDHLRTHQRTHTGETPYKCTE
CGKCFSHSGSLISHKRIHTGEKPYKCIECEKSFTTASHLRTHQRIHTGEKPYRCGECVKS
FVSCSELRSHWRIHTGEKPFKCECDKSFFTSSALRKHQRIHARENVTNPLLMEATLELIR
NFIQERNL
Download sequence
Identical sequences XP_015845530.1.50099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]