SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015852337.1.50099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015852337.1.50099
Domain Number 1 Region: 153-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.17e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.41e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-22
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 7 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.93e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 98-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-20
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 563-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 10 Region: 2-44
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000353
Family KRAB domain (Kruppel-associated box) 0.0006
Further Details:      
 
Domain Number 11 Region: 256-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000106
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 12 Region: 48-90
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000317
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015852337.1.50099
Sequence length 632
Comment PREDICTED: zinc finger protein 431-like isoform X1 [Peromyscus maniculatus bairdii]; AA=GCF_000500345.1; RF=representative genome; TAX=230844; STAX=10042; NAME=Peromyscus maniculatus bairdii; AL=Scaffold; RT=Major
Sequence
MEEWALLDPSQKNLYNNVMLETYMNLSAIGYTWEDHKVEEHCQSSQRHGRHERSYTGDQS
SEWTLCVNSFAYQSHLQRHERIHTGKKLYEGIHYSEDFACHSSLQIHQGTRTIGKPYECK
QCGKAFARPSHLQMHERTHTGERPYECNQCGKAFAQHSHLQLHKRTHTGERPYECNQCGK
AFVQYSHLRMHERTHTGEKPYECNQCGKAFPRYSHLQRHERTHTREKPYECNQCGKVFAQ
HSHLQRHERTHTGEKPYGCNQCGKAFVCFGDLQLHKRTHTGEKPYECNQCGKAFAQHSHL
QRHKRIHSGEKPYECNECGKAFACNNSLQRHERTHTGERPYECNQCGKAFSRLSTLKLHK
ITHNGEKPYECNQCGKTFAHHSYLQKHERRHTGEKTYECNECGKAFACHNHLQRHGRIHT
GEKPYGCNHCGKAFDCHSHLQRHERTHTGEKPYGCNQCGKTFVCLGYLQSHKRTHTGEKP
YECNKCGKAFARHSHLQRHGRMHTGEKPYECNQCGKAFICHSDLQTHERIHTGEKPYECN
QCSKAFVHHSDLQRHKRTHTGEKPYECNQCGKAFPRLSSLQLHGRTHTGEKPYGCNQCGK
AYSQHSYLKIHKKTHTGEEPYKSNTISVELVC
Download sequence
Identical sequences XP_015852337.1.50099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]