SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015858399.1.50099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015858399.1.50099
Domain Number 1 Region: 285-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 508-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-24
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 396-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-24
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 452-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.28e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 200-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.32e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 135-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.22e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 550-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 9 Region: 11-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-19
Family KRAB domain (Kruppel-associated box) 0.00023
Further Details:      
 
Domain Number 10 Region: 105-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000738
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 11 Region: 247-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000172
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 12 Region: 64-120
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000179
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015858399.1.50099
Sequence length 608
Comment PREDICTED: laforin isoform X1 [Peromyscus maniculatus bairdii]; AA=GCF_000500345.1; RF=representative genome; TAX=230844; STAX=10042; NAME=Peromyscus maniculatus bairdii; AL=Scaffold; RT=Major
Sequence
MGELGSQDVNAVTYADVHINFTREEWALLDPSQKKLYKDVMLETYRNLTAIGYSREDHNT
ENHFQSSRRCGRHERNRTGEKVSENTECVKTLAYHSHLQLHESTYTEEKPYECNPCDKAF
ADFSPLQSHKRTNNGEKTYKFNQCGKIFAHQNNLQRTHTGEKPYECNQCGKTFAHHSSLQ
RHKRRHTGEKPFECNQRGQAFAHHSGLQIHRRSHTGEKPYKCNQCGKGVASPRSLQRHKR
VHNGEKPYECDQCGKAFVCQSGLRIHKRTHTGEKPYKCNQCSKGFSVHSKLQIHKRTHTG
EKPYKCNQCDKAFSQRVHLRVHRRTHTGEKPYKCNQCGKAFAYQRGLQRHKRRHAGVKPY
ECNLCGKAFVCQNGLHLHKKRHTGEKPYKCNQCDKAFLCRSNLKTHQRTHTGEKPYECSQ
CGKAFGCPRILQLHIRTHTGEKPYECSQCGKAFAHQNSLQIHKRTHTGEKPYKCNQCDKA
FACQRSLQIHIRTHTGEKPHECSHCGKAFGQRSHLRIHKRTHTGEKPYKCNQCDKAFVCA
SQLRSHNRIHTGEKPYKCNQCGKAFAHQNTFQIHKRTHTGEKPYECNQCGKAFICHSHLQ
NHKRTHTA
Download sequence
Identical sequences XP_015858399.1.50099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]