SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015910760.1.5422 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015910760.1.5422
Domain Number 1 Region: 344-507
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 3.53e-63
Family A middle domain of Talin 1 0.0000116
Further Details:      
 
Domain Number 2 Region: 607-742
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.47e-47
Family I/LWEQ domain 0.0000252
Further Details:      
 
Domain Number 3 Region: 516-636
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.85e-43
Family I/LWEQ domain 0.0000309
Further Details:      
 
Domain Number 4 Region: 1078-1215
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.83e-34
Family VBS domain 0.035
Further Details:      
 
Domain Number 5 Region: 1700-1827
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.57e-32
Family VBS domain 0.00012
Further Details:      
 
Domain Number 6 Region: 38-152
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-29
Family Second domain of FERM 0.00000922
Further Details:      
 
Domain Number 7 Region: 153-243
Classification Level Classification E-value
Superfamily PH domain-like 2.66e-24
Family Third domain of FERM 0.0000491
Further Details:      
 
Domain Number 8 Region: 928-1061
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.07e-20
Family VBS domain 0.031
Further Details:      
 
Domain Number 9 Region: 1267-1409
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000392
Family I/LWEQ domain 0.0067
Further Details:      
 
Domain Number 10 Region: 1540-1667
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000000487
Family VBS domain 0.022
Further Details:      
 
Domain Number 11 Region: 1449-1513
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000152
Family VBS domain 0.042
Further Details:      
 
Domain Number 12 Region: 799-888
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000053
Family I/LWEQ domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015910760.1.5422
Sequence length 2017
Comment talin-2 [Parasteatoda tepidariorum]; AA=GCF_000365465.2; RF=representative genome; TAX=114398; STAX=114398; NAME=Parasteatoda tepidariorum; strain=Goettingen; AL=Scaffold; RT=Major
Sequence
MEQLKKKLKTDDDLNWIDHSKTLREQGIEEEETLLLRRKFFFSDQNVDSRDPVQLNLLYV
QARDAIIKGTHPVTIEQGAQFAGIQCQIQFGDHVETKHKSGFLDLKEFLPKDYVKSKGIE
KKVFAEHKKCVGDSELDAKVKYVSLARSLKTYGVTFFLVKEKMNRKNKLVPKLLGVTKDS
VLRLDEKTKEILKTWPLTKVRRCAASPNSFTLDFGDYSDSYYSVQTSEGEQISQLINGYI
DIILKMKKAKDHLGIEGDEGSAMVEENVSAAKATILQHQPPAKVSHVDSGSVVVPAVMRT
GVNGPMPYTTGQTQGAQFGESRGQAHSAYASVQMQHPKVHTTMSEPQRALLSTITSGRSA
VENAQNNLNVRIKLQELGTDPASIQWKQNQMDVKKQNVSSQLAAMNAATAQVITLTSGPA
EDVDHPAVGAAVTTITTNLSEMSNDVKMIAALMDDEMQGENLLDAARNLCSAFSDFLKAA
EPETKEPRQNLLNAAGRVGEASHAVLRNIGEEDAIDKEIQDILLGLAKRVATATANLVLK
AKNVASKCDDQAQQNAVIIAATQCALASSQLLACAKVVAPTISNPTCQQQLIEAAKEVSR
AVEGINKACNDATRDPVLLDNMDKASNDVEDALNDLVNHVKTVNKQRAQASVHDGAVDTI
LDATDKLFSSTGDAGEMVRQAKILATATATLIQAIKGEADSQSDSDIQKRLLAAAKILAD
ATAKMVEAAKGCASNPHDSASQAALQKAAEDLRSATNAAANNALKRKLIRRLEQAAKHTA
AMSTQNIAAAQGARLYNRNPSSQDELMTCCKDVADVIPKLVQGVKSTMMDVDNPSAQLSL
ISSCETMLQPGNKMVAASKAAIPTITDPSTSLQLNNATKQMINALMELRSSLIKAQEACG
SLELENALDLIRGLDDELVAFRRAAENMNLKPLPGETLENSALQLGSISKVVGSSMAQLL
TAASQGNENYTGIAARDTGSALKILTKAVRGVAATTNDKDVQLKIIDNARDVMDKSTLLI
HESQRAMNNPSNPDIQQRLTQVAKSVSNALNNCVNCLPGQKDVDDAIRSITDASQILNSG
HFPHPNKSYGELQSNLTNAAANLNVAATDVVAASKGSPAHLATSSKKFGSAFNELLDSGV
EIIGGTKDTEIRSSMVISLKNVSMVSSKLLVAAKSVAADPGAPNAKNQLAAAARSVTESI
NNLINVCTSATPGQKECDNAIRNIQSMRPLLDNPVEPINDLSYYECLDAVTEKSKNLGDG
MTGIANFAKSNEQEQFGHSVNDVSNAVCGLIEAAAQAAYLVGVSDPSSVAGRQGLVDVAQ
FARANQAIQSACQQLTNSVSNQQQILSAATVIAKHTSALCNSCRIASSKTSNPVAKRHFV
QSAKDVANATANLVKEIKALDQDPTEKNRQNTSTAIKPLVEAVENLTTFASSPEFASVPA
KISPKARIAQEPITSSGKNIIDGSCNMIVSAKSLVVNPRDPPTWQTLAGHSKNVSDSIKK
LVASIKDKAPGQKECDAAIEKLSSCIRELDRASLSIIGQNSLPRKDHSLKGYQEQMESSA
SEILERIDGVRTAAMGEAEKLGHLVTQMTSFFDPLVHSAIGSASKTINSKQQMALLDQTK
TVAECALQLIYASKEAGGNPKASHIHCELDESADGMKEALHDLMRTVECAATEAGVVTGL
VDTINRAIVKVDERDGIEVPESSFVDFQTRMVTNSKEIAKIAQEMIVKSGTDAAQLGPLA
GRLAHLFENVAIDTRGAISSTPNLDVANRIKTSVQDLGSACIDLTKAAGTCQSNPSDTYS
QRDVSDSARTVTEKVSFVLAALQAGSRGTQACINAASTVSGIIGDLDTTIMFATAGTLHA
ENENETFSDHRENILKTAKALVEDTKTLVAGAASSQEQLAVAAQNAVTTIIQLAEVVKLG
AASLGANNSDAQVLLINAVKDVATALGDLVQATKAASGKNIHHPAMINLRDSAKVTVRES
YTSDEWLHSDQEDELIRLLSEQSEALDEVDTTPLLVH
Download sequence
Identical sequences XP_015910760.1.5422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]