SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015913077.1.5422 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015913077.1.5422
Domain Number 1 Region: 73-525
Classification Level Classification E-value
Superfamily Sema domain 4.19e-109
Family Sema domain 0.0000463
Further Details:      
 
Domain Number 2 Region: 1396-1521,1699-1857
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.45e-44
Family p120GAP domain-like 0.02
Further Details:      
 
Domain Number 3 Region: 875-966
Classification Level Classification E-value
Superfamily E set domains 0.000000000000127
Family Other IPT/TIG domains 0.029
Further Details:      
 
Domain Number 4 Region: 970-1058
Classification Level Classification E-value
Superfamily E set domains 0.000000000000255
Family Other IPT/TIG domains 0.018
Further Details:      
 
Domain Number 5 Region: 528-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000907
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 1058-1124
Classification Level Classification E-value
Superfamily E set domains 0.0000000624
Family E-set domains of sugar-utilizing enzymes 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015913077.1.5422
Sequence length 1919
Comment plexin-B [Parasteatoda tepidariorum]; AA=GCF_000365465.2; RF=representative genome; TAX=114398; STAX=114398; NAME=Parasteatoda tepidariorum; strain=Goettingen; AL=Scaffold; RT=Major
Sequence
MSIVIYSPLEEDDEQSSCPPIKQLRRRKRTMAKTGNQSVLVNVFHTVLLAAWATSICHAQ
HEGSVVASYRTYNDSINFTHVVVDYQTGRVYVGATNWLYQFNSSLDVEANVRTGPVEDSI
FCFPTGCADQQLSTINNVNKVLVIDRDANMLISCGSVHQGACQRHSLQDIGNHEKLVPMP
VAANDENSSTYAFIGPARYSGLLQTRVLYVATTNSRLGPYRDVVPAICSRSLESSKLFTI
IERSFSSIARVDVSFHLRDYYLVNYVFGFDSGDYVYYATVQRKSHLRALEEWGYITRLSR
VCVSDVGYDTYTEVTLQCVGEDGTDFNLLQDASVIKAVGDLAADLRVDPGSDVLVGVFAA
SKDHTTRPGAHSAVCVYSLSEIEQRFTENIHMCYNGSVLTRDMDYIAGSINQCPEPGKAG
NILNFCNETVKLNGSVPISSLAAIVYSNTTLTSVAMTTTGQHTVAFVGTGDGVLKKLLVT
SSMEAEEFEEVVVDSGNPIIGDVVLDPTQQYVYAASPYKLSKIRIETCQQYSTCDKCLQA
RNPYCGWCSLERRCTIKVACQNATWSFNDRSSPRWLSLETKQCIDFQAVRPDQLPYKSMS
IVELVIHQLPQLPYAAHYLCVFGDGPPIQARETHTGLACMTPVMPARPPILPTEDHVTVN
LAVRSSETETDFIHRPFVFYDCEVHRTCKACVTSSWACSWCVHENTCTSNATTCSRRVIV
GESNPQNSLIKGRQHCPSFNIDDEILLPNGVRKEISIGIKNLLTPLEGFQCVVEIEGAKE
RVFARVRDNTVICAENMYSYEAEIGQVQASLTVLWNGDTFIDKTNVTLYKCHLLGSHGGR
ADCSLCMTRERKYQCAWCGSSCSYSESCIDPVATSCPPPHIDWIHPLSGPLEGGTLVTIE
GSNLGSSEEEIQDKVTIGGIPCIPVEYSISVRIVCRTGVNMNGPMAAAVVVGNRAGVTRA
QEKFHYKAIELTGVYPNVGPQSGGTRLYLKGTNLNIGSQIEVMLDDLPCRVERSLASSSQ
ISCRTSRSSVPSYVVSQLVLRIDGANITYPNPFTYTSDPTLRYIHPLKSFMSGGRYVKVM
GTNLTSVQQPRMMVFNEHNVVNETVCQVTNASTMLCPSPAVRPDSLKLRSQHWRSYDEMR
LKIGFVMDDVQPVREMQNYFPTLPNEIIYVPDPKFYVLSKDGVKLYKGESLVIEGENMRL
ASTEGEINVTIGTRSCNLTSLSMTQLVCLPPEVQPPGTDEMGRRTENSLPLVVVRAGTNL
RYQIGYLRYEVAKTSEFPPEAIGGIAAGGAILMLLILGILAALRHKSSQAEREYKRIQLQ
MDTLENSVRSECKQAFAELQTDMSDLNNDIQATGVPTLDHRTFVMKVFFPGVADNPVIEE
CKQMNGPQNMYEIAMAQFEQLLCNRNFLLAFIETLEEQKSFSIRDKVNVASLLMIIFLEK
MEYATSILKELLLRLIDKYVGTKHPQLMLRRTESVVEKMLTNWMALCMYNYIKDQAGGSL
FLLFSAIKHQVEKGPVDAITHDARYSLSEERLLREQTEYSPVTIQVIHEDQDEKMQCKVN
DCDTISQVKAKILDSLYKNTPFSQRPSIYDVDLEWRHGRGGHLILADEDLTAKAANGWKR
INTLAHYGIRESAVMCLVARRKDMLNCLRSAYNGPLISGSPHMGNCIEDGPRVRYWHLVR
NLDDHHDYHKDHCHKAIPEIFLTRLLSTKGTIQKFVDDFLTTILSAKESLPPAVKWLFDL
FDEAAARYGISDPEVVHAWKSNSLPLRFWVNLVKNPDFVFDIEKTPIVDSCLSVIAQTFM
DSCSTSEHRLGKDSPSNKLLFARDIPTYRKMVNRFYQDVANLPPVTEQEMCVSLQMLSMA
HAGEVDSVNALKELYIYVSRYGNQILETLDSDPVCQSQHLAGKLETVAYTISGGEASLC
Download sequence
Identical sequences XP_015913077.1.5422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]