SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015977553.1.101085 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015977553.1.101085
Domain Number 1 Region: 52-548
Classification Level Classification E-value
Superfamily Sema domain 1.16e-100
Family Sema domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1412-1537,1703-1859
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.37e-33
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 980-1070
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000248
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Domain Number 4 Region: 889-978
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000496
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 5 Region: 1068-1148
Classification Level Classification E-value
Superfamily E set domains 0.0000000000377
Family E-set domains of sugar-utilizing enzymes 0.052
Further Details:      
 
Domain Number 6 Region: 551-602
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000209
Family Plexin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015977553.1.101085
Sequence length 1927
Comment PREDICTED: plexin-D1 [Rousettus aegyptiacus]; AA=GCF_001466805.2; RF=representative genome; TAX=9407; STAX=9407; NAME=Rousettus aegyptiacus; AL=Scaffold; RT=Major
Sequence
MARRAAGGAPLSARAAAASPPPPRPPFWAPPPCPLLLLLLLGAVRAGALEIQRRFPSPTP
TNNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQASCEHPR
RLTDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTVFPS
MLNVAANHPNASTVGLVLPPAADAGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPEI
AIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPPDPPPGAPSYAY
LALNSEARAGDKESQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRL
VSVFPARELLFAVFERPQGASAARAAPAALCAFRFADVQAAIRAARTACFVEPAPDVVAV
LDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQHPLSILQPLKAMPVFRAPGLSSVAVAS
VSNYTVVFLGTVSGRLLKINLNESMQVVSRRVVTVAYGEPVHHVMQFDPADPGYLYLMTS
HQMARVKVAACAVHTTCGDCVGAADAYCGWCALETRCTLQQDCANSSQQHFWTSASEGPG
RCPTMTVLPAEIDVRREYPGMILQISGSLPSLSGMEMTCDYGNHIRTVARVPGPAYGHQI
AYCNLLPKYQFPSFPPHQDHVTVEMFVRVNGRNIVGANFTIYDCSRIGQVYPHTACTSCL
STQWPCFWCTQQHACVSNQSQCEASPNPTSPQDCPQILPSSLAPMPTAGSQTIPVHLANA
AFFQSAALECSFGQEEIFEAVWVNESTVRCNQVVLHTTQKSQVFPLSLQLKGRPARFLDS
PDPMTVEVYNCAMGSLDCSQCLGREDLGHLCVWSDGCRLRGPLQPLPGTCPAPEIRAIEP
LSGPLDGGTLLTIRGRNLGRRLSDVVYGVWIGSVACEPLADRYTVSEEIVCATGPAAGAF
SDVVTVNVSKEGKSRERFSYVMPLVYSLEPAMGPKAGGTRITIHGSDLHVGSELQVLLND
TEPCTELVRTDTSIACTVPGGTLPAPVPVCVRFERRGCVRGNLTFWYMRNPVIMAISPRR
SPVSGGRTITVAGERFHMVQNVSMAVHHIGRQPTLCKVLNSTLITCPSPGALSNASAPVD
FFINGRAYADELAVAEELLDPEEAQRGSRFRLDYLPDPQFSTAKREKWIKHHPGEPLTLV
IHKEQDSLGLESHEYRVKIGQVACDIQIVSERVIHCSVNESLGTAEGQLPITIQVGNFNQ
TIATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQI
REEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYILPSQTL
NSQGSSPVQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAV
RDRCSLASLLTIALHSKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWM
SICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNL
NVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSY
ILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYFHLVL
PTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVK
YFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVI
AQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMTPLSEQEMNAHLA
EESRKYQNEFNTNVAMAEIYKYAKRYRPQIMTALEANPTARRTQLQHKFEQVVALMEDNI
YECYSEA
Download sequence
Identical sequences XP_015977553.1.101085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]