SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015988744.1.101085 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015988744.1.101085
Domain Number 1 Region: 29-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 236-351
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000353
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 3 Region: 440-477
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000511
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 150-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 196-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 401-438
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015988744.1.101085
Sequence length 755
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 isoform X1 [Rousettus aegyptiacus]; AA=GCF_001466805.2; RF=representative genome; TAX=9407; STAX=9407; NAME=Rousettus aegyptiacus; AL=Scaffold; RT=Major
Sequence
MWGSSAPSRCFLPKGEASTFRPPLLTAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSW
YIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEAFRLCGSAIPPAFISARDH
VWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQSDEFRCDNGKCLPGPWQCNTVDECGDG
SDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPAERRCDGTQDCGDGSDEAGCPDLAC
GRRLGNFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEGL
GERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQP
CGSSSEADVSDVGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYTSA
DRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVP
RKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYG
QLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRLGRLWNRLFHR
PRAPRGQIPLLTATRTSQTVLGDGLLQPAPGAAPDPQAPLTDTGSPGAAGDMPPSAPGHV
PEVGPSVPPASGLRDPECRPVDKDRKACRDPLVDSLAPVDTPWEPCSAPDAHPPAPTASS
TLGSHPAEPLGVCRSPQAPCSPTLEASDDEALLVC
Download sequence
Identical sequences XP_015988744.1.101085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]