SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015997429.1.101085 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015997429.1.101085
Domain Number 1 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.7e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.93e-21
Family KRAB domain (Kruppel-associated box) 0.00043
Further Details:      
 
Domain Number 4 Region: 401-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-19
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 6 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-19
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 7 Region: 569-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 8 Region: 289-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.6e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 499-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000115
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 11 Region: 610-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000102
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 12 Region: 84-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000137
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015997429.1.101085
Sequence length 663
Comment PREDICTED: zinc finger protein 14-like isoform X1 [Rousettus aegyptiacus]; AA=GCF_001466805.2; RF=representative genome; TAX=9407; STAX=9407; NAME=Rousettus aegyptiacus; AL=Scaffold; RT=Major
Sequence
MDLVAFEDVAVNFSSEEWALLDSLQKELYRDVMRETFRNLVSVGEKWEDHDIEDQYKNRG
RKLRSHMVKRIREGKEGSQCGRNFSLISNLNLKKKILFGVKPQKNSVCGKVFIHHSSHSK
HIRCHTGHKPFEYQKYEEKPYKCNICGRAFSYVQCFEKHERKHNGEKTYKCEECGKAYSS
STSLQIHERSHIGDKLYACKQCGKAYRYYSALQTHERTHTGQKSYECKQCGKAFSSHLGF
QIHDRSHTGEKPYECKKCSKAFSCLSYLRSHEKIHTVEKPYECKECGKAFRYYHNYQTHE
KKFTGERPFECKECGKAFRCYQSFQKHERIHTGGKPYECKECGLAYRYYSTLQRHKRTHT
GEKPYKCKQCGKAYRGHSALQTHERTHTGQKPYDCKECGKVFISHLGFQIHERSHTGEKP
YECKQCSKSFSCVSYLRRHEKIHTGEKPYECKQCGLAYRYYSTLQRHERTHTGEKPYECK
ECGLAYRYFSTLQSHERIHTGRKPYVCKECGKTFRWYQSFQTHERNYTGEKPYVCEKCSK
QFSCPRYLRKHERNHTARKRYECKNCNKAFRYPSDLQKHERNHTGEKPFECKQCCKAYKD
QSSLQTHETHTGEKPYECKECGKAFIYHTTFRRHMTMHTGEKPRKVQNLGKASVIPFSFE
SMK
Download sequence
Identical sequences XP_015997429.1.101085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]