SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016001113.1.101085 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016001113.1.101085
Domain Number 1 Region: 271-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000557
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 892-944
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000086
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 728-774
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000367
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 406-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000138
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 949-998
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000146
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 766-824
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000017
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 7 Region: 859-900
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000458
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016001113.1.101085
Sequence length 1228
Comment PREDICTED: zinc finger protein ZFAT isoform X1 [Rousettus aegyptiacus]; AA=GCF_001466805.2; RF=representative genome; TAX=9407; STAX=9407; NAME=Rousettus aegyptiacus; AL=Scaffold; RT=Major
Sequence
METRAAEHTAIFMCKCCNLFSPSQSELLSHVSEKHAEEGVSVDDIIIPLRPLSTPEPSNP
GKAGDELSVMKRKRGRPKGSTKKPSAEEELAEKLVCPSEDSLLALADGSGLAPGSLECAK
CCRKFSNARQLRKHVCIIVLNLGEDDAEAGNESDLELEKKFKEEDREKAPRRPRTQRTEK
AQRTASSGKEARQAAGAKKPIISVVLTAHEAIPGATKIVPVEAGPPETGATDPEATSADT
APRRGYQEYAIQQTPYEQPMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKP
YKCPQCSYASAIKANLNVHLRKHTGEKFSCDCCAFTCLSKGHLKVHIERVHKKIKQHCRF
CKKKYSDVKNLIRHIRDAHDPQDKKVQEALDELCLLTREGKRQLLYDCHICERKFKNELD
RDRHMLVHGDKWPFACELCGHGATKYQALELHVRKHPFVYVCALCLRTFVSTIRLRTHIG
QAHGAAPEAAVFASSINQSFCLLEPGGDIQQEALGDRPPLEEEEELVFQAANAPQEAGAR
QGPEGRAEEPGPPVRLAAQRAGHTEGPSALRPALHSHTGVPGAFPLKNGTSSAEAHSAPE
QPLDAQHRGAAHAQDGGAVLQPVARSPDAHREIQCTEGPPGEGPQTVAQPPEGPHPSRRP
AASPAEGPDLPLPAGGTDAALGQPEPCTPAPEPRASTSAFMRVLDSLQKRRMDTGLCARI
RKVYGDLECEYCGKLFWYQVHFDMHVRTHTREHLYYCSQCHYSSITKNCLKRHVIQKHSN
ILLKCPTDGCDYSTPDKYKLQAHLKVHTELDKRSYSCPVCEKSFSEDRLIKSHIKTNHPE
VSMSTISAVLGRRVQLKGLIGKRAMKCPYCDFYFMKNGSDLQRHIWAHEGVKPFKCALCE
YATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQFKCTVCDYTA
AQKPQLLRHMEQHASFKPFRCAHCHYSCNISGSLKRHYNRKHPNEEYANVGAGELAADAL
VQQGGLKCPVCSFVYGTKWEFNRHLKNKHGLKVVETEGEPKWEPATEAPEDAPTQYLHVT
DAEEDVQGTQAAVAALQDLRYTSESGDRLDPTAVNILQQIIELGTETHDATAVASVVAMA
PGTVTVVKQVTDEEPSANHTVMIQETLQQASVELAEQHHLVVSSDDVEGIETVTVYTQGG
EASEFIVYVQEAMQPAEEPAVGQAAQDL
Download sequence
Identical sequences XP_016001113.1.101085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]