SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016018428.1.101085 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016018428.1.101085
Domain Number 1 Region: 227-482
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.84e-66
Family Eukaryotic proteases 0.00000011
Further Details:      
 
Domain Number 2 Region: 45-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-23
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 3 Region: 192-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000556
Family Complement control module/SCR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016018428.1.101085
Sequence length 486
Comment PREDICTED: complement C1r subcomponent-like protein isoform X1 [Rousettus aegyptiacus]; AA=GCF_001466805.2; RF=representative genome; TAX=9407; STAX=9407; NAME=Rousettus aegyptiacus; AL=Scaffold; RT=Major
Sequence
MPGLRRGNYLWGSPHSTSCPGKMWWLLLWGVLQACPTQGSVLLAQQLPQQLTSPRYPEPY
LKGQESTTVIEAPKGYAVRLVFQEFDLEPSQDCEQDSVTITASGMDPQRFCGQHGSPLGN
PPGQREFVSSGSSLQLTFCAPASSENKTTLLHKGFLALYQAVSINHSQPISQVSRGSETT
HTPGDNLFKTQNHCQEPYYQTVPSGMFTCTAQDPWKETQDREEVPHCVPVCGRPVIPIAQ
NQEVQGSSKAKLGNFPWQAFTIIYGRGGGALLGDRWILTAAHTIYPKDSISLRKNRSVNV
FLGHTKTEELIKLGNHPVRRVVVHPDYHQNDSHNFDGDIALLELQHSVPLGPRLLPVCLP
DSETLYRSGLMGYVSGFGVEKGWLTTELKYSKLPVAPREACKAWLQEKQRSEVFSDNMFC
AGNKTWQQSVCQGDSGGIYVVWDDRAHHWVATGIVSWGIGCGKGYGFYTKVLNYVDWIKR
VMDGKD
Download sequence
Identical sequences XP_016018428.1.101085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]