SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016022639.1.80810 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016022639.1.80810
Domain Number 1 Region: 36-320
Classification Level Classification E-value
Superfamily L domain-like 2.04e-39
Family Ngr ectodomain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016022639.1.80810
Sequence length 425
Comment uncharacterized protein Dsimw501_GD15547, isoform B [Drosophila simulans]; AA=GCF_000754195.2; RF=representative genome; TAX=7240; STAX=7240; NAME=Drosophila simulans; strain=w501; AL=Chromosome; RT=Minor
Sequence
MCNSWLVLIIALSVVVCLWNSQQTETSKSCPAECICLSQTQVLCNTGGLEQIPLRQLPAT
VENLALTKNNFPIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQ
MVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTSNIKLILLTNNPLIRIDSSAFSSLTN
VGHLILPSGIRSIEQDAFFGMDTVGLLKLAYMDLKEVAPFTFRGLSNVLLLTLQESDLGV
ICADAFTGLTQVETLQILNNKIDSIEELNFTSTAAIKHLKFFGNHVLETPDPNSIIVDGV
EHLQLVSNHFPCGCHIHTLLDGPLAEGAHNLTDFLQKNYCISPLEVNGRVMSELDIDSIG
RCSDQLTKGNLGSSAASLALGINSMLLIAVASCAEWRHVRLLANRLAQLLGHVAWRRRRK
RRKGN
Download sequence
Identical sequences Q9VR83
FBpp0297617 NP_001259742.1.81976 NP_001259743.1.81976 NP_001259744.1.81976 NP_608382.2.81976 XP_016022639.1.80810 XP_016022640.1.80810 XP_016022641.1.80810 FBpp0297617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]