SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016031012.1.80810 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016031012.1.80810
Domain Number 1 Region: 507-669
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.44e-64
Family A middle domain of Talin 1 0.0000401
Further Details:      
 
Domain Number 2 Region: 678-800
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.18e-51
Family I/LWEQ domain 0.0000756
Further Details:      
 
Domain Number 3 Region: 2299-2488
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.79e-51
Family I/LWEQ domain 0.00013
Further Details:      
 
Domain Number 4 Region: 770-906
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.16e-43
Family I/LWEQ domain 0.00017
Further Details:      
 
Domain Number 5 Region: 1851-1982
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.08e-34
Family VBS domain 0.00037
Further Details:      
 
Domain Number 6 Region: 1235-1371
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.94e-34
Family VBS domain 0.014
Further Details:      
 
Domain Number 7 Region: 203-317
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-29
Family Second domain of FERM 0.00000981
Further Details:      
 
Domain Number 8 Region: 318-408
Classification Level Classification E-value
Superfamily PH domain-like 1.74e-25
Family Third domain of FERM 0.0000575
Further Details:      
 
Domain Number 9 Region: 1093-1218
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000129
Family alpha-catenin/vinculin 0.032
Further Details:      
 
Domain Number 10 Region: 962-1062
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000765
Family I/LWEQ domain 0.0045
Further Details:      
 
Domain Number 11 Region: 2017-2141
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000155
Family VBS domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016031012.1.80810
Sequence length 2835
Comment uncharacterized protein Dsimw501_GD14103, isoform B [Drosophila simulans]; AA=GCF_000754195.2; RF=representative genome; TAX=7240; STAX=7240; NAME=Drosophila simulans; strain=w501; AL=Chromosome; RT=Minor
Sequence
MSTLSLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKFAEAVQGQPSEYGLFISDEQNQQ
GVWLEPGRTLGYYILHNQDTLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTK
IGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMN
WVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQ
DKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRTKGIEKKIFSEHRKHVDLSE
IDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISW
PLTTVRRWGASPNTFTLDFGDYANQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGI
EGDEGSTMVEESVAPSKATFLQHETNRMEQLNVESLAHPGIMRPYDGERSYMENEVQTVQ
YGAFVGQVNHAHQPPTTKEVRISSVNLTEPQRALLGYISAGQDVLIRADEELRTKAPIQE
LGSDLRSIEWRENTLDTSKQAVSSHVATMSAATAQIITASHPDEVDTEAISASVSQIAQT
IPEVTKEVRLIAALMENDTNGDQLLEAARNLCNAFSDLLKAAEPESKEPPQHLINAASRV
GEATTHVLSTIAEEEVPENRDLHDMLLALAKAVANTTAALVLRAKNIAASCEDEQARNRV
IGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNEASNDPK
LKADLLAAARDVSKSLTDMLEHVKLSSREHANRTSTELSPVENVIIGTDILVSTHDPQEM
VRHARTLGQTTAQLIQSIKGEADQQQDADMKRHLLSAAKQLADATAKLVEAARLCSSNPH
DSDNQNALRKAAEELREITTTAANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQH
SQDHQTKETLLQDCKRVADTIPRLVTSLKTTRAQPDDPNAQLNLIEAAEQFIEPALQVSK
SSRALQPTVTDIPSATQLSKGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHD
VLDDTRQAAIAGQLRPLPGQTVENTADELRKSAKNVGIALSQLLSSVLHNQRSYAGAAGR
DTALALGDFTRSVHGVAATTQNPAIIDCADDVVTSSARLIEQAQRTLQGATNPEALTQAG
REVTGALSATVDCIPGQREVDVALRNVSELSEILSMSEFPPSSRPYATLQSELKQVAEQL
SSAGGEIVVSYSSPALLAESSQNFAANYRDLLSVSMEMAGQTQEEEVRSHMIESLRHVST
QSCSLLSTAKSIAADPGQPNAKNLLHAAARGVTESINQLVDASIQSAPGQKECDNAMRNI
EALRLMLDYPHEPINELGYFDCVEQATGKSRNLGYAISEMINNAKQSQHVEFSQSVNNVN
DSIQGLIESSSQAAYLIGVSHPSSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQ
MISALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQAIKAIEEQP
AGGSRERLVDPLLEAVKAVRQYASSSEFSSVPAKISAEGRKAQEPVIQAGRGVIDGVVEM
VKAAKSLALTPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTR
ELDSCALAVNAQGLSQRRDNNLHGFSGQTMNSASELIDKLEPIRVAGKNNAEQLGHAVGE
ISRYVVPMVNGAIGACTHIVHSQQQMSLIQQTRSVVESAITLVQSAKDSAGNPRATHAHP
RLDDAIDGTREAIQELQQTVEKINAETGIVTGLMEQVNRSITRLTDKRQSLLNASYSDTF
VDYQTRMVARAKEIASLANEMNAKSSVEPSALPQLAVDMTQNYQQLTQDSVGASTTTSSP
DVAMRIRTTVIDLGRSVSSMIQSSAGGARPNDVGAQKEIARSAREVSEKVAQVLAALQAG
SRGTQACINAAHTVSGIIGDLDTTIMFATAGTLHSDGDGSFADHREHILQTAKALVEDTK
VLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASAL
GDLINCTKLASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVE
AISQEIRAMHSPPPVGNTQVGPEDLIRVTMNVTAATAKAVAAGTSNLQADIVSAANLGRR
AISEMLIVCRSVAWNCAETEELRSRTLEAGTAVGESYRDLLSGILHNCSADDRMHLSRRV
AKCVTDLVAMARLLKGSDWIDPEDPTVIAENELLGAAASIDAAAKKLASLRPRRQADVKI
ELDENMKFDEMILEAAKGIMGASAALVRAANAAQRELIDTGKVARRPLTSSDDGQWSEGL
ISAARLVAAATHSLVEAAQNLVRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAG
RRLQAAGNAVIKSTDNLVHSAQQGLDEMVEDSIKINTSMVDGMAQEINARSAVLRKEKEL
EEARQLLKNVRHAQRYAKNAQGFTTDESDTEYAYRSQNNTLGRSGYYGSSEMRSSPSYLS
GGQQQKHHYHASPQPQHFHHPGAVSPPPSNYPPMDDPNGDFPPPPPPLSTTISNMQTATS
GHSFRPNPKLTANAVPRPYPGSPGGSNGLIPAPTTSGTPTNTNYQQSYESSSIKTLNSSP
PAVPKKPAVNRNLAACVQDLHDKTFGQGGVVQLTGGNGYPGQNYEGYTSRYETRNFDKSA
NNTTSSSSELGAVKPLESSFSQMTLNTDGGKISIVDQGSERLTSMTQRVMERKSFTTTTE
SRSETKTEKHSFRLD
Download sequence
Identical sequences A0A0J9RRS3
XP_016031012.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]