SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016033574.1.80810 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016033574.1.80810
Domain Number 1 Region: 838-981
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 8.11e-32
Family Toll/Interleukin receptor TIR domain 0.0006
Further Details:      
 
Domain Number 2 Region: 145-442,588-654
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000122
Family Ngr ectodomain-like 0.036
Further Details:      
 
Domain Number 3 Region: 710-779
Classification Level Classification E-value
Superfamily L domain-like 0.00000502
Family Ngr ectodomain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016033574.1.80810
Sequence length 985
Comment uncharacterized protein Dsimw501_GD19483 [Drosophila simulans]; AA=GCF_000754195.2; RF=representative genome; TAX=7240; STAX=7240; NAME=Drosophila simulans; strain=w501; AL=Chromosome; RT=Minor
Sequence
MLIAVLGPIKISFKCNNSMQQTKLLLTIPDDYCETYCGGDICNDTVDPKTCDREAYDYIA
TNEYHLIMRDGHLEVKWKIPDPKIFNLSPISKENHLKLNELTVSDTSYQIRAVDYLRQLG
VETVTRFENQLNSFKTIERNVHYINGPKSLKIIIQSNLYLNEIIEYINKITDNINEIIIN
AYKAVENQQLRLDNLIFNGKSHLRSLTFIGFQIENVSTKPFDQFINLRKMVLSKCTVQNL
TFVSNLQKSLEHLELDIDNEVDLKYFTNFPSLKLMKVRKYIPNENFTALVCTQNNCNFIR
GINGLECPKLCQCLYIFDDLELNIDCSNLGLLQIPPLPIPIFGGVKLNFSNNFLSQLPTM
TLPGYKSVTRLDVSRNMLTHLSINHLPAKLDYLDVSFNEIINMDNALIKYLRNVTIFKQS
GNQWTLQCDDKPLLNFFRHLKLIIRMKSVEVRPMFLHSLTELPKGFLKFLGKHFIWLGVR
KQEYYLIDEEQLLHSMHRKLNNLTTIMSIYKNMEWLHQKLILVNQEYDLFYIREMAAPCP
HKCECCYSRDSLILKIDCSNKFVYNFPDIVGRNSRLLGKQNIFIPMELHLSKNNISNITI
AMLPKEIRFLDLRFNNLVTLDDKVLSYLKKNSIKTKLSGNPWNCDCKSRSVLSILRDHEP
LEYDVTLKRCNISRTDCPDACVCCLDNLTWPSFIVDCRGEGLLQMPKLSSRVTYVDLRNN
SLTALSQKNRSYFEKRSLKLLLLDNPWSCTCNDIEKVNFMKSVSSSILDFTEIKCSNGEK
LVSINEHIVCPSELVYYLALAISLVATIIALNFLIWFRQPVLVWFYEHGVCLSLAARREL
DKDKRFDAFLAFTHKDEALLEEFVDRLERGEPRFRLCFYLRDWLAGESIPDCIGQSIKDS
RRIIVLMTENFMNSTWGRLEFRLALHATSRDRCKRLIVVLYPNVKNFDSLDSELRTYMAF
NTYLERSHPNFWNKLIYSMPHTKLR
Download sequence
Identical sequences XP_016033574.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]