SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016036009.1.80810 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016036009.1.80810
Domain Number 1 Region: 192-535
Classification Level Classification E-value
Superfamily DNase I-like 5.1e-38
Family DNase I-like 0.078
Further Details:      
 
Domain Number 2 Region: 49-163
Classification Level Classification E-value
Superfamily L domain-like 1.63e-19
Family Ngr ectodomain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016036009.1.80810
Sequence length 552
Comment uncharacterized protein Dsimw501_GD18310, isoform I [Drosophila simulans]; AA=GCF_000754195.2; RF=representative genome; TAX=7240; STAX=7240; NAME=Drosophila simulans; strain=w501; AL=Chromosome; RT=Minor
Sequence
MKGNHYKMSRNKDKYDSANRRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEH
LTALYLNDNQLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVL
PYEIGKLFHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNLSFTVNPPPQRPWLPL
AKPNKTRPACIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIIS
LQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKE
SLIEFNQLAMANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPMSEVTQISQPLLVCTA
HIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLCGDFNSLPDSG
VVEFLGKGRVSMDHLDFKDMGYKSCLQRLLSNDTNEFTHSFKLASAYNEDIMPHTNYTFD
FKGIIDYIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTAS
QQAPPNGLINRR
Download sequence
Identical sequences Q7K112
FBpp0083951 FBpp0083953 FBpp0083956 NP_732965.1.81976 NP_732966.1.81976 NP_788732.1.81976 XP_016036003.1.80810 XP_016036006.1.80810 XP_016036009.1.80810 FBpp0083951 FBpp0083953 FBpp0083956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]