SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016036141.1.80810 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016036141.1.80810
Domain Number 1 Region: 637-752
Classification Level Classification E-value
Superfamily Bromodomain 5.49e-31
Family Bromodomain 0.0011
Further Details:      
 
Domain Number 2 Region: 507-618
Classification Level Classification E-value
Superfamily Bromodomain 2.22e-30
Family Bromodomain 0.00022
Further Details:      
 
Domain Number 3 Region: 175-294
Classification Level Classification E-value
Superfamily Bromodomain 1.31e-27
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 29-155
Classification Level Classification E-value
Superfamily Bromodomain 3.92e-24
Family Bromodomain 0.0015
Further Details:      
 
Domain Number 5 Region: 367-445
Classification Level Classification E-value
Superfamily Bromodomain 3.4e-18
Family Bromodomain 0.0023
Further Details:      
 
Domain Number 6 Region: 1302-1374
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000393
Family HMG-box 0.0012
Further Details:      
 
Domain Number 7 Region: 761-866
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000209
Family Bromodomain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016036141.1.80810
Sequence length 1654
Comment uncharacterized protein Dsimw501_GD18270 [Drosophila simulans]; AA=GCF_000754195.2; RF=representative genome; TAX=7240; STAX=7240; NAME=Drosophila simulans; strain=w501; AL=Chromosome; RT=Minor
Sequence
MLSRKRRASSISSRQDEDPLQLDDSTPEQSPVQQTTTQSARKKRRLDPTELCQQLYDSIR
NIKKEDGSMLCDTFIRVPKRRQEPSYYDVVVNPIDLLKVQQKLKTDSYDDLDDLMADLEL
LIGNAKAFYLPGSSEHQDAVSLWQHIHSQRQRIMEANGLAEEEPRARRMSRQVRRMTSST
EPGGDGATDDEYNQYEELFASVMTASDPVGDRLMHRMFQLLPSKKIYPDYYDVIEHPIDL
RLIATKIQMNAYSSLAEMERDLLQMTKNACLFNEPGSQIYKDAKSLKRIFTQRRIELEMG
KGKLAKRVKSLSSAAIAALKEEVDSSDDEETSKKGEGPMWALFDHLYNAPGTSEHPGVTG
PPLGNSLWKLPVRRFHPEYFDLIKRPISMSQIHTKLKKGDYANISDLTADLYLMLDNAKK
AFPTSHRTHKDALKMLKLMNAKLVEESLEEGSDLDDEDAEEMDAEVFRVSTQPEKRKPGR
PRINSNSNSNASHTPNNSNSPKSNRIAINAAIKKKILSIQKYLVDYSLGNRRPIEMFMEK
PPRKIYPDYYDIIQNPIDMNTIEHNIRTDRYAAVEDVVSDYRLMFSNCRQYNEEGSNIYE
DANILERALNEKLKEFPGLTEGKKTQQKYSKVGRKLKTAVITERLWQFYETVKEYQEPKG
KRQLSLIFTKLPSKSEYPDYYDIIREPIDMDRIAQKLKQGAYDTLDDLAADFLLMLENAC
KYNEPDSQIYKDALVLQQLTLQLKQQLRTERDSLPDVPLAVQELFLTLFTTIYNHQDEEG
RCYSDSLAELPEYDEIGEGPKVRGISLDLVKRRLDKGAYKRLDVYQEDIFACLERARKLS
RTDSDIFQDSIELQTYFIRKRDELCKDTLSSSALTFSLERLMADVELCRQQKMQQEEQDQ
EQDKEKDEFNAAKGESMTINQQVFSPGDYVYVQMPENKIPSICCIERLWTSPTNEKLMQA
SIFVRPHETYHVTTRKFLEKEVFKSSLSQTISMDKVQGMCYVMNIKDYIKMRPENLPEKD
VYVCESRYNIQGRWFKKLKSWPPVREGSSVKFVPREQPLELKRVMSVFKERLEKHKGELE
ELKLQETLVEKEKPNVSCDPPPNAEDGSTYYQQYNTICSGAIKTGDFVYVATQTGKQSVA
QVQQIWEQNGKSYFKGPWLLPPSETTPGLSKQFYRQELLLSTVEEVSPVVGIVGRCAVLE
YSEFISSRPTEISESDVYICESVYDELKKALRKLVTGNMRKFQHSPSVTEDEIFYFKTPI
KPSKDFKNELNELGMLEDSMDGDTPSLSSDIAAMSSPAPSVNSTPLTSKVKAAKSAKKCL
TGYILYSSEVRKSICQSNPDATFGDISRMVGTEWKNLPSSVKQSWEDRASRQNEETAALR
RELDDVQNSASPSPQVSQDVYGQVLTFECQWDKCDFQFEELGDCTEHCMSDSTGHIQRHP
QAGVETEYVCLWRNCPRVKKSIQAFPNVLRLIKHVREVHLSKCGKTISAADRSKNFVPRR
QKHAQLATTVPIPPSLAQSPRAPSNLDAVQLQQQQHPQQNMHQLQQQQTIVLGPPPEPLF
VTVPPRTTRVIHSEAYIKYIESLQTGSHLNVATCNNNWRRALTHITPAQVVSKAALPEKW
IGPNLRDQGNVVQALCHLRNFMVDDILQIRRSCN
Download sequence
Identical sequences XP_016036141.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]