SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016044429.1.11023 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016044429.1.11023
Domain Number 1 Region: 323-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.34e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 5-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-20
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 5 Region: 127-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 407-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 490-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 532-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 89-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.89e-16
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 10 Region: 369-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000071
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 285-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000169
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 453-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000155
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016044429.1.11023
Sequence length 609
Comment PREDICTED: gastrula zinc finger protein XlCGF57.1-like [Erinaceus europaeus]; AA=GCF_000296755.1; RF=representative genome; TAX=9365; STAX=9365; NAME=Erinaceus europaeus; AL=Scaffold; RT=Major
Sequence
MERSLGTVSFDDVKVTFSWEEWQLLSDAQRNLYQTVMLETYSSLTALGRGVSKPEVIVKL
EQGAEPWTVAEPPPRSLSAFRIFHRRKIPYECSECKKTFFDKSYFKTHLKIHTGERPYEC
KVCAKNFCWKSSLNLHLKTHTGEKPHECEVCHKTYSQKSYLVLHLKTHTGQRPFKCTECQ
KTFYQRSDLRRHLNIHTGERPYECPECAKTFCWKSSFRLHMRSHVRDRPHECPECHKTFA
QKSYLELHQRTHTGEGSFDCQECKKSFCKKSDLKRHLKTHTGEKPYACAECHKAFSDKSY
FRAHLRSHTGERAYECPACRKIFYQKSYFKTHLKIHTGERPHECPQCAKTFCWKSSLKLH
LKTHTGEKPFACPLCAKAFSYKSNFNMHLRSHTGERAYECPDCRKLFYQKSYFQRHLKSH
KGERPHGCPECAKTFCWKSSLNLHLKTHTGEKPYACPLCAKAFSDKAYFKTHLRSHTGER
AHECPHCPKVFYQESYLQKHLHTHSRERPHGCPQCAKTFRWKSSLNLHLKTHTGEKPFEC
AECQKIFYQKGDFQAHQKVHTGEKAYQCPQCPKTFCWKSSLKKHLKSHSGEETARESKPR
PEGPGGAPG
Download sequence
Identical sequences A0A1S3WE71
XP_016044429.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]