SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016048603.1.11023 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016048603.1.11023
Domain Number 1 Region: 216-393
Classification Level Classification E-value
Superfamily MIR domain 6.93e-47
Family MIR domain 0.0023
Further Details:      
 
Domain Number 2 Region: 1080-1207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-17
Family SPRY domain 0.043
Further Details:      
 
Domain Number 3 Region: 660-795
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000356
Family SPRY domain 0.064
Further Details:      
 
Domain Number 4 Region: 102-186
Classification Level Classification E-value
Superfamily MIR domain 0.00000405
Family MIR domain 0.028
Further Details:      
 
Domain Number 5 Region: 441-551
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000798
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 6 Region: 2202-2272
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000144
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 7 Region: 4056-4134
Classification Level Classification E-value
Superfamily EF-hand 0.0000149
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016048603.1.11023
Sequence length 4889
Comment PREDICTED: ryanodine receptor 1 [Erinaceus europaeus]; AA=GCF_000296755.1; RF=representative genome; TAX=9365; STAX=9365; NAME=Erinaceus europaeus; AL=Scaffold; RT=Major
Sequence
MGDGGEGEDEVQFLRTDDEVVLQCSATVLKEHLKLCLAAEGFGNRLCFLEPTSNAQNVPP
DLAICCFILEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSC
LTTSRSMTDKLAFDVGLQEDATGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYL
HLSTASGELQADASFMQTLWNMNPICSCCEEGYVTGGHVLRLFHGHMDECLTISSSDSED
QRRIVFYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLALTEDQGLV
VVDASKAHTKATSFCFRISKEKLDVGPKRDIEGMGPPEIKYGESLCFVQHVASGLWLTYA
APDPKALRLGVLKKKAILHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLDS
FSGKPRGSGPPVGTALPIEGVILSLQDLIGYFEPPSEELQHEEKQTKLRSLRNRQSLFQE
EGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCALF
STNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVL
DVLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQYS
KWYFEVMVDEVTPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLH
LWTGHVARLVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPV
VSFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLV
GPSRCLSHMDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDN
KRLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYM
MSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIVARRNPR
LVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQESSQVDSQSRWDRVRIFRAEKS
YAVQSGRWYFEFEAVTTGEMRVGWARLELRPDVELGADELAYVFNGHRGQRWHLGSEPFG
RPWQPGDVVGCMIDLTENNIIFTLNGEILMSDSGSETAFRDIEIGDGFLPVCSLGPGQVG
HLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEAVPLEHPHYEVARV
DGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPSGLQPPSE
DEARAAEPDSDYENLRRSAGGWGEVEGGKDGTIKEGTPGSTTQAGGEAQPTRVENEKDAT
TEKSKKRGFLFKAKKVAMMTQPPATPTLPRLPREVVPMDNRDDPEIILNTTTYYYSVRIF
AGQEPSCVWAGWVTPDYHQHDMNFDLSKVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGDF
VSPGQQGRISHTDFVIGCLVDLATGLMNFTVNGKESNTFYQVEPNTKLFPAVFVLPTNQN
VIQFELGKQKNIMPLSAAMFLSERKNSAPQCPPRLEMQMLMPVSWSRMPNHFLQVDTHRA
GERLGWAVQCQDPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLCLYRAVCALGNNR
VAHALCSHVDQAQLLHALEDAHLPGPLRAGFYDLLISIHLESACRSRRSMLSEYIVPLTP
ETCTITLFPPSKGGEEDDGPRRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGVAEAPAR
LSPSIPLEALRDKALRMLGEAVRDGGQQARDPVGGSVEFQFVPVLKLVSTLLVMGVFGDE
DVKQILKMIEPEVFKEQEEEEEEGEEEEEDEEEKEEDEEEEAQEKEDEEKEEEEEEEETA
EGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQGNQR
GRYGLLMKAFTMSAAETARRTREFRSPPQEQINMLLHFKDGTNDEDCPLPEDLREELAKF
HQDLLAHCGIQLEGEEEEPEEEATLGSRLKSLLEKVRLLKKKEEKPEEEPPAEESQPKSL
QELVSHTVVRWAHEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSMEDTMS
LLECLGQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNV
LGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLD
VAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGEHYLDF
LRFAVFVNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDG
PGVRRDRRREHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIR
AILRSLVPLDDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIEN
QDFLLHVLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEH
RAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILN
EFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLSRKLFWGIFDSLAHKKYDPE
LYRMAMPCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDTF
INKFSEYTHEKWAFDKIQSNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLK
AMIAWEWTIEKAREGEEEKTEKKKTRKISQNAQTYDPREGYNPQPPDLSGVTLSRELQAM
AEQLAENYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKSRDREKAQELLKFLQMNG
YAVTRGLKDMELDTSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQE
IKFFAKILLPLISQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRV
SLYGTDAPAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGK
VSQARTQVKGVGQNITYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYS
LGTTKNPYVEKLRPALGECLACLAAAMPVAFLEPELNEYNACSVYTTKSPRERAILGLPS
SVEEMCPDIPVLERLMADIGGLAESGARYMEMPHVIEITLPMLCSYLPRWWERGPEMPPP
GAPPPCTAVTSSHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLHTHF
IPTIGRLRKRAGKVVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVDN
NRAHWLTEPNSNAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKM
AKAGDVQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLITMAKI
RYALKDTDEEVREFLQNNLHCQGKVEGSPSLRWQMALYRGLPGREDDADNPEKIVRRVQE
VSAVLYHLEQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYK
ALWILTEDHSFENRMIDDLSKAGKKKEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLVE
DYLYMAYADIMAKSCHLEEGGENGEGEEEEAEVSFEEKEMEKQRLLYQQARLHNRGAAEM
VLQMISACKGETGAMVSSTLKLGISILNGGNADVQQKMLDYLKDKKEVGFFQSIQALMQT
CSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNND
FQNYLRTQTGNTNTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVA
KQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLD
LQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQ
DYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARE
IGFNVAVLLTNLSEHVPHDPRLRTFLELAESILEYFRPYLGRIEIMGSSRRIERIYFEIS
ETNRAQWEMPQVKESKRQFIFDVVNEGGESEKMELFVSFCEDTIFEMQIAAQISEPEGEP
EEDDDEGGEGDEEAAAHEAGPGGADRAVAVVDGAPFRPEGPGGLGDMGDTTPVEPPTPEG
SPIIKRKLGVDGEQEELPPEPEPEPEPEPEPEKTDAENGEKEAPEPPPEPPKKTAAPSPP
PKKEGGSAGLEFWNELEVQRVKFLNYLSRNFYTLRFLALFLAFAINFILLFYKVSDSPPG
EDDTEGSAAGDLSGAGSGSGSGWGSGAGEEAEGDEDENMVYYFLEESTGYMEPALRCLSL
LHTLVAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQWDRLVLNT
PSFPSNYWDKFVKRKVLDKHGDIFGRERIAELLGMDLSSLEITAHNERKPAPPPGLLTWL
MSIDIKYQIWKFGVIFTDNSFLYLSWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILS
SVTHNGKQLLMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMY
VGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQE
QVKEDMETKCFICGIGSDYFDTTPHGFDTHTLEEHNLANYMFFLMYLINKDETEHTGQES
YVWKMYQERCWDFFPAGDCFRKQYEDQLS
Download sequence
Identical sequences A0A1S3WQF9
XP_016048603.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]