SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016049271.1.11023 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016049271.1.11023
Domain Number 1 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 2 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.17e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.06e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 6 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.27e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 1-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-16
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 579-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000403
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 144-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000118
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 10 Region: 520-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000225
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 84-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000247
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 12 Region: 620-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000547
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016049271.1.11023
Sequence length 681
Comment PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 14-like [Erinaceus europaeus]; AA=GCF_000296755.1; RF=representative genome; TAX=9365; STAX=9365; NAME=Erinaceus europaeus; AL=Scaffold; RT=Major
Sequence
MAVSQDAISCEDVTVNFSQEEWALLNPSEKKLYKDVMWEIFHNLVLIGKLQEDSFIEQQQ
DHEGSKQRNIEDKISEKKEGSRYRENPHESEICHKKFTCSSYLLTYERIQSRENPCMCKL
CHKEFIQSSKVWTNERFQSGDNFYECEQQCSKTFSQSSSLQMHERTYIGEKPYECKTCSK
TFIQSSHLQIHEKTHSGEKPYKCKQCSKTFSNSSSLRRHQRTHREEKSCRCEQCGKTFSG
SSYLRVHERTHSGERPYECKQCSKAFGYPFALQIHERTHSGEKPYECKQCSKTFSSSGSL
LRHERTHSGEKPYECKQCSKTFITSSHLRVHERTHSGEKPYGCKQCSKTFITSGHLRVHE
RTHSGERPYECKQCSKAFGYSFALQIHERTHSGEKPYKCKQCSKTFICSSHLRSHERTHS
GEKPYECKQCRKTFSQYSSLQTHERTHSGEKPYECKQCSKTFSSLGSLRKHERIHSGEKP
YECKQCRKTFITSGHLRVHERTHSGEKPYEYKQCSKTFSSSSLWAHEIALSGEKPYEYKQ
CSENFITSGHLWVHESAHSGERPCECKQCSKAFATTVLFICFISLWKHERIHSGEKPYXC
KQYSKAFDYLFTIRINERTHSREKPYECKQCSETSISFSHLHSLEGTHSREKSYGCKQSH
KTLSSQSSLDTGKNTQLYETL
Download sequence
Identical sequences A0A1S3WSD4
XP_016049271.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]