SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016054602.1.3490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016054602.1.3490
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 4.97e-36
Family CSE2-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016054602.1.3490
Sequence length 144
Comment PREDICTED: mediator of RNA polymerase II transcription subunit 21 [Miniopterus natalensis]; AA=GCF_001595765.1; RF=representative genome; TAX=291302; STAX=291302; NAME=Miniopterus natalensis; AL=Scaffold; RT=Major
Sequence
MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFSNIQTAINKDQPANPTEEYAQLFAA
LIARTAKDIDVLIDSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQS
ALADIAQSQLKTRSGTHSQSLPDS
Download sequence
Identical sequences A0A2I2UX14 A0A2K5J1A9 A0A2K5RLJ6 A0A2K6KZR4 A0A2K6QC08 A0A2K6TE90 F6VIS6 G1R051 G3TSL3 J9P8B8 L5M850 M3YGG4 S9XEZ4
ENSVPAP00000011314 ENSLAFP00000018571 ENSNLEP00000006572 ENSMPUP00000010421 ENSMPUP00000010421 9615.ENSCAFP00000016443 9796.ENSECAP00000020623 ENSFCAP00000021339 ENSNLEP00000006572 ENSECAP00000020623 ENSCAFP00000041986 ENSECAP00000020623 NP_001184240.1.84170 NP_001229441.1.31192 XP_002917154.1.58354 XP_003265678.1.23891 XP_003405750.1.64505 XP_003926646.1.74449 XP_003988566.1.62641 XP_004270946.1.21590 XP_004383655.1.4749 XP_004405361.1.74151 XP_004435528.1.5094 XP_004776463.1.14098 XP_006194143.1.101512 XP_006200017.1.17985 XP_006737989.1.47382 XP_006758987.1.95426 XP_007075695.1.5354 XP_007119218.1.24612 XP_007194937.1.59432 XP_007446351.1.90284 XP_007446352.1.90284 XP_008138728.1.99482 XP_008514058.1.77740 XP_008691377.1.72690 XP_010378162.1.97406 XP_010944851.1.22495 XP_010995417.1.51371 XP_011802364.1.43180 XP_014702353.1.49734 XP_014920692.1.86478 XP_016054602.1.3490 XP_017362537.1.71028 XP_017720010.1.44346 XP_019307832.1.44245 XP_019791727.1.83887 XP_021546260.1.83697 ENSLAFP00000018571 ENSCAFP00000041986 ENSVPAP00000011314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]