SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016074421.1.3490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016074421.1.3490
Domain Number 1 Region: 1016-1082
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-20
Family TB module/8-cys domain 0.00000943
Further Details:      
 
Domain Number 2 Region: 345-413
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.4e-20
Family TB module/8-cys domain 0.00041
Further Details:      
 
Domain Number 3 Region: 1191-1251
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.49e-17
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 4 Region: 799-925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000282
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 679-798
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 226-296
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000327
Family TB module/8-cys domain 0.0036
Further Details:      
 
Domain Number 7 Region: 546-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000142
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 8 Region: 292-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000382
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 9 Region: 916-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000794
Family EGF-type module 0.018
Further Details:      
 
Domain Number 10 Region: 587-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1327-1378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000354
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 12 Region: 1297-1342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000754
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 1134-1179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000871
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 14 Region: 77-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000653
Family EGF-type module 0.019
Further Details:      
 
Domain Number 15 Region: 629-676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000073
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 16 Region: 1095-1143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016074421.1.3490
Sequence length 1393
Comment PREDICTED: latent-transforming growth factor beta-binding protein 1 isoform X8 [Miniopterus natalensis]; AA=GCF_001595765.1; RF=representative genome; TAX=291302; STAX=291302; NAME=Miniopterus natalensis; AL=Scaffold; RT=Major
Sequence
MDTKLMCLLFFFSLPPLLVSNHTGRIKVVFTPSICRVTCTKGSCQNSCEKGNTTTLISEN
GHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKLCQIPVHGASVPKLYQHS
QQSGKALGTHVVHSTHTLPLTMTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGP
TGQKVKEAQPGQSQISYQGHPVQKTQTVHSTYSHQQVIPHVYPVAAKTQLGRCFQETIGS
QCGKALPGLSKREDCCGTVGTSWGFHKCQKCPKKPAYHGYNQMMECLQGYKRVNNTFCQD
INECQLQGVCPNGECLNTMGSYRCICKMGFGPDPTFTSCVPDTPVISEEKGPCYRLVSSG
RQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSGVHRRRPI
HHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEK
EIPSLDQEKTKLEPGQPQLSPGVSTIHLHPQFPVVIEKTSPPVPVELAPEASTSSSSQVI
APTQVTEINECSVNPDICGAGHCINLPVRYTCICYEGYKFSEQQRKCIDIDECSQAQHLC
SQGRCENTEGSFLCICPAGFMASEEGTSCIDVDECLRPDVCGEGHCINTVGAFRCKYCDS
GHRMSPGGHCQDIDECLSPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECQDPK
VCANGTCSNLEGSYMCSCHKGYTPTPDHKHCKDVDECQQGNLCINGQCRNTEGSFRCTCG
QGYQLSAAKDQCEDVDECQHQHLCAHGQCRNTEGSFRCVCDQGYRASALGDHCEDINECL
EDNSVCQGGDCINTKGSYDCTCPGGFQLNDNKGCQDINECEQPGLCGPHGECLNTAGSFH
CVCEQGFTISGDGRTCEDVDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVD
VNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRASGDVEVEQPGEEKKE
CYYNLNDASLCDNVLAPNVTKRECCCTSGAGWGDNCEIFPCPVLGTAEFTEMCPRGKGFV
PTGESSYEDGGRDYKDADECLLFGQEICKNGFCLNTQPGYECYCKQGTYYDPVKLQCFDM
DECQDPSSCIDGQCINTEGSYNCFCTHPMVLDASEKRCVRPTESHEQIEETDVYQDLCWE
HLSDDYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPVTGRRRPY
GRDALVDFSEQYAPEANPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCF
DGYHLDMAKMTCVDVNECDELNNRMSLCKNAKCINTEGSYKCLCLPGYVPSDKPNYCTPL
NSALNLDKDSDLE
Download sequence
Identical sequences XP_016074421.1.3490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]