SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016085027.1.42290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016085027.1.42290
Domain Number 1 Region: 37-517
Classification Level Classification E-value
Superfamily Sema domain 7.32e-94
Family Sema domain 0.00044
Further Details:      
 
Domain Number 2 Region: 1384-1507,1673-1829
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-34
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 856-948
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000294
Family Other IPT/TIG domains 0.025
Further Details:      
 
Domain Number 4 Region: 946-1039
Classification Level Classification E-value
Superfamily E set domains 0.00000000000077
Family Other IPT/TIG domains 0.073
Further Details:      
 
Domain Number 5 Region: 1039-1116
Classification Level Classification E-value
Superfamily E set domains 0.000000000168
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Domain Number 6 Region: 520-572
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000244
Family Plexin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016085027.1.42290
Sequence length 1897
Comment PREDICTED: plexin-D1 isoform X1 [Sinocyclocheilus grahami]; AA=GCF_001515645.1; RF=representative genome; TAX=75366; STAX=75366; NAME=Sinocyclocheilus grahami; AL=Scaffold; RT=Major
Sequence
MPPSPADRRSLRLLAAALAVFLTALQARTAGALQIQQAFASPSRTNNFVVDAVSRRVYLA
AVNTLYQLNSTLAREVETRTGPVLDNPLCHAPQLPQATCEHQKTLTDNHNKLLTLDRTQG
VLLACGSVFQGFCELRAMDDASRLAVRFPQDGATVFPSMLNIAANHENASTVGLVFRSHG
GAARLLVAATYTGMGSEYFPKNHSKEDLRFENTPEIAIRSLDIADLGRLFTYDINPSEDN
VFKIKQEVKQKNKLSFVHAFVHKSYSYIAINNDANAGVKESQPNSILARICLDTDAPRRS
AESRKLTESYIQMGLQCGSSGNIYSRLLSIYPADISSGGAAGAEPHLFGVFAQAGGRAAV
CAFRVLEVEERIRQGRRNCSSGPNSNVQVLDSVIQGSGAECEHKGAIKLQEEQLNCGAAH
LQHPLALRRPLRARPIYEAPGLSSIAVDNVHNCTVMFLGTSRGRLRKLSLLANLSVANQW
SLKLASNEPVHHIMTFDPSDHNYLYLMTTHNLLRVQVSACGQYSSCSECVSAGDAHCGWC
TLERRCSVQKNCSSGTLGRSWISTGDGAQQCPSMTITPSEISRSAHMRNVGILIDGSVPD
LQGLQVECDYGVGITTNATVHLDYSTTQIQTCPLLPLHMYPTIPFGTDHITVPMAIRVNG
VSVVSGNFTIYECERTGEIHFKTACTSCLSTAWHCYWDLQLNRCVSSKESTPRVLLENSS
FCPSMLADDVPPLPSGNTHVFSLELKNIDHGAELDCDLGDGQLYRAQWLDGLAVNCSGVT
LKTTMWSKKFQLNLRRRGTSTYIDSPEPMTVEVYSCSAGDSDCSQCWGRQTQGHMCVWCE
NSCQQRDQCHAITTRCPDPHIQKVEPLSGPLTGGTLLTVQGRNLGHSATQLSVSIGHVPC
SVLPQHYTVSARLVCETGASWEQTSDHVTVRVAGNAVGVSKDIFSFVEPRLQEFTPRQGP
LAGGTRLTIHGQFLDAGSTVNVEINQTQNCTIFMLSRDVIKCVMPPAKPAVAENVSVCVV
YDDRPCLSASPSFTFTYEKNPTISHIRPNKSFLSGGRSISVTGYGFNLVQSVRMEVSGVG
QTSCSYVSSTLIICQSPAANQSQQAMARFYLNEVLYRGEDASPSGRGPDEDEEPHADAFH
FDYVEDPQFYTANKEKLIKHHPGEPLILIINKGPSELDLTLQEYSVTIGSDLCDITFHNE
QLFHCTINRSLSASTGELPVTVRVGHFQKVIAMVQMGGGSELAIIVSIVVCCVLLLLCTV
ALVVYCTKSRRAERYWQKTLLQMEEMESQIRDEIRKGFAELQTDMTDLTKELSRTQGIPF
LEYKQFVTRTFFPKMCSDYERRLVQPMYENDPLGPRALSETHPLLQDWQSSNSVRPNLEE
GITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKELLV
DLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKG
SIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGFGMDSVSVRVMNTDTICQVKDKIL
EAFYKNLPFSQWPREEDVDLEWFPEGRSSRILQDLDNTSVMEDGRKKLNTVFHYQIPDGA
SLAMSMKDKRENTLGRVKDLDTEKYVHLVLPHDELTESRKSHRHNHRKKVLPEIYLTRLL
STKGTLQKFLDDLFQAILSIPPEKPPLAIKYFFDFLEEQADKRGITDPDTLHIWKTNSLP
LRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSLSDLQLGKDSPTNKLLYAKEI
PEYKKRVQCYYKQIQEMAPLSEQEMNAHLAEESRRYRNEFNTNLAVMEVYKYAKRYRNQV
VSALDSSPTARRTQLQHKFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences XP_016085027.1.42290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]