SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016097486.1.42290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016097486.1.42290
Domain Number 1 Region: 232-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-25
Family Clostridium neurotoxins, the second last domain 0.051
Further Details:      
 
Domain Number 2 Region: 597-736,769-784
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000000959
Family Astacin 0.095
Further Details:      
 
Domain Number 3 Region: 1299-1364
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000104
Family Complement control module/SCR domain 0.0047
Further Details:      
 
Domain Number 4 Region: 1359-1431
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000236
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Domain Number 5 Region: 1428-1485
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000264
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number 6 Region: 507-609,692-771
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000154
Family Reprolysin-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016097486.1.42290
Sequence length 1636
Comment PREDICTED: pappalysin-2-like [Sinocyclocheilus grahami]; AA=GCF_001515645.1; RF=representative genome; TAX=75366; STAX=75366; NAME=Sinocyclocheilus grahami; AL=Scaffold; RT=Major
Sequence
MMFFRLLAIILAIFHTWPLNRAQPDHLQKYKRTLAQRANRALAGEQCGSISRKRPLHSAA
QQYPLAGVAGRYTRLIDLHLRKTKTVRSCSGECSSSGTNTVALTNLDINEKVKYEEPQEE
TFIWKKAGKQPQEATDPGSTKSHKPLQSISKGHPLQAEQGGDLTDSSFSLRRVARSLPEF
NKEEVPKDMQRTHIHHTDFSTENEELSGEQEGLQSTAGEPWRVDVHNMPAKWMTAVYFSG
QADQLKVNPAFGIELPHSWFTLELWVKPDGGQNNPAIIAGVFDNCSYPLSEKGWSVGIRA
VDPTGRKDGRFFFSLRMDRALKSTTIIAHQRYQPNSWTHVVASYDGHKMALYVDNSKVGE
SREQSGDLYSPYIKACRMFLLGGDQSDHEHSFRGHLGGVTLWGYARTHEELLKGHQSHAE
RQTPILSQWADFSEVENQWAPYKDRHNPIIVALPVPERQLVSPFLPPPCGMTVCDNADVA
LSYNQQWQLQVEKHLRYRIVNICKDDGSDPTVSLQQIQLQHQALEDAFRPYNITLELSIH
TIYNSSLQRRFVLSNCHIAKVGNRHCNPECDHPLTGHDGGDCLRMGPCYNWKRRDGVCNP
ECNSIHYDYDDGDCCDPEVTDVAKTCFDPESSQRAYMSVKELKELLHLSSSDTLNVFFAN
NSAREELAGVATWPWAKEALTHQGGMILNPFYFGTKGHNNTMIHEMGHILGLYHVFKGVS
ERESCDDPCQETTASMETGDLCADTAPTTKSKVCHDPDPVNDTCGITQYQNTPYNNYMSY
TGTPDVYQPCEPSMQAWSPEVNLYEPNMTTPCPQIEGCMLELHFLHPVVPDSLTIWITYT
SANKKAIANIVFIMENGEMVHTGPQHAFCDIPLTLHLHTSKKVKAVKISTFDKKLEIDAV
LLTSRPQNPLCSSCRPLLYRVLREPPIREDWSPVIVKQPTYTDSDVQRDVQYLYRIQVES
DGLFSELSPGLVYIHGEHFCGDGTLQGTEDCDDGNLLDGDGCSKKCQVEPGFKCHGQPSL
CYAFEGDGVCEEFEVRSSIQDCGFFTPQGFTDQWASIASGSHQDQRCPASKVTGEPVLTQ
MCKSQYFGINEVVAHDAWSPCTAHLNSYYTKDQPVWLKVGFERPGVAASVIIYLAYDGSW
HGENCRKTVTIELCDTTGKKHLLGSYELSCQYNPLVVNVTHNLSVPFYRTSAVQLNFSSS
QVAVLAVALRTSCHFSAFALTGCVRRLCSAESCSPLNVEHASVRCTPVIDSKHCSVSCHR
GYTLTVLQGQGLPSHQMEAELICVHGVWDRVVSCQPVDCGPPPQSHVYFASFSCPWGTTF
GKRCTFSCNAPAILQGESDTLVCLEDGLWSYPEAYCKIECPDPPSVPNASLLVPQCHGGG
HDVGTVCHYKCNLGYYVTGTLNKKPRKKFLRLECLEGGMWQEGSCSPVTCPPLPLMFEGM
YTCTNNLDFDSICTLQCPDSTERSSIRCTKDGKWTEDFIMCKKIEGPCQPPLDLNLVEYS
CEDGFDVGAVCYPTCIVALSDPVVLSNGSSADTVEHWMLPSKVQSIVCTGMLKWHPNPGQ
IHCIQSCEPFRGDGWCDTINNRAYCQYDGGDCCPSTLSSRKVIQFGVDCDHDECTCRDPE
AEENKGTAKRKEPGPL
Download sequence
Identical sequences XP_016097486.1.42290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]