SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016100325.1.42290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016100325.1.42290
Domain Number 1 Region: 30-275
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-32
Family Ankyrin repeat 0.00044
Further Details:      
 
Domain Number 2 Region: 279-325
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000955
Family SOCS box-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016100325.1.42290
Sequence length 383
Comment PREDICTED: ankyrin repeat and SOCS box protein 1-like [Sinocyclocheilus grahami]; AA=GCF_001515645.1; RF=representative genome; TAX=75366; STAX=75366; NAME=Sinocyclocheilus grahami; AL=Scaffold; RT=Major
Sequence
MNEQKVCHNLRGWLQEQFGDRPLEQCEDMSLHNAAHVGDLDTLKTLLQEESFKQRINEKL
IWSCGLLPCTPLRIAAMMSHSECVDYLISQGAAVDLVDVKGQTALYMAVVNGHLDCVKIL
LKAGADPNGSIHHRSTPIYHTAQVGRVEILLELIRIHTGSKLIHRLDQRFMFGTRTLTTL
AACPLFISAAYHHLPCFRMLLNASANPNFNYNGPVSRDALVRGRAFCMLDAVLKLGCEPA
FVSLLLDHGADPYLVPWDELDPDTMVRLKVNAEVFRIYQEAKRNPRRLMNLCRITIRKIM
GKKRLAQGSCISSLPLPETVINFVSQGLMYLCFSMLTVDELKGMSGHSLSNTTYMETNDF
HKTGSWNGKTITLVCCDIKTTSC
Download sequence
Identical sequences XP_016100325.1.42290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]