SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016114096.1.42290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016114096.1.42290
Domain Number 1 Region: 490-653
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.31e-70
Family A middle domain of Talin 1 0.000000115
Further Details:      
 
Domain Number 2 Region: 1569-1758
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.37e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 3 Region: 883-1019
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.2e-37
Family VBS domain 0.025
Further Details:      
 
Domain Number 4 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 1.02e-35
Family Second domain of FERM 0.000000788
Further Details:      
 
Domain Number 5 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-25
Family Third domain of FERM 0.00000822
Further Details:      
 
Domain Number 6 Region: 733-865
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 9.26e-23
Family VBS domain 0.031
Further Details:      
 
Domain Number 7 Region: 1126-1213
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000157
Family I/LWEQ domain 0.0075
Further Details:      
 
Domain Number 8 Region: 659-697
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000314
Family I/LWEQ domain 0.0018
Further Details:      
 
Domain Number 9 Region: 1256-1317
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000738
Family VBS domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016114096.1.42290
Sequence length 1817
Comment PREDICTED: talin-1-like [Sinocyclocheilus grahami]; AA=GCF_001515645.1; RF=representative genome; TAX=75366; STAX=75366; NAME=Sinocyclocheilus grahami; AL=Scaffold; RT=Major
Sequence
MVALSLKIGVGNVVKTMQFEPSTVVYDACRIIRERVPEAQLGQPSDYGLFLSDEDPKKGI
WLEAGKALDYYMLRNGDTLEYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIG
ITNYDEYSLVRDVGEEKKEEATGTLKRDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEESEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
YQCQIQFGDHNESKHKPGFLDLKEFLPKEYIKNKGEKRIFQAHKNCQNMTEIEAKVSYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPNKSTVLQQQFNKVGKVETGSVALPAIIRSGAGGPESFQMGSMPQAKQHITSGQM
HRGHMPPLISAQQALTGTINSSMQAVQAVQASLVEFDALPPLGTDAASQAWRKNKMDESK
HEIHSQVDAITAGTASMVNLTAGDPAETDYTAVGCAVTTISSNLTEMSKGVKLLAALMED
EGGRGQQLLGAAKSLACAVSEMLKTAQPASTEPRQNLLQAAGNVGQASGELLQQIGESDA
DQHNQDMLMQLAKAVANAAAALVLKAKKFCLVVDTYKTAQEACGPLEIDNALTMVRGLER
DMQEAKASASEGKLKPLPGETLEKCSQDLGSSTKAVSSAIAQLLSEATQGNENYTGMAAR
DVAQALRSLASAARGVAANTEDPHARNAMLDCTADVMDKSASLIEETKRAIAKPGDPDSQ
QRLAQVAKAVSQALNRSVNCLPGQRDVDNAIRTVGEASKKLLSDKFPVSGKSFQKAQANL
NEAAAGLNQSANELVQASRGTTQDLSKASGKFGQDFNHFLLAGVDMAGQSQSKEDQTQVV
TNLKTISMSSSKLLLAAKALSTDPNSPNLKNQLAAAARAVTDSINQLISMCTQQAPGQKE
CDNALRELETVGGMLENPTEAVSDMGYFDCIDSVMENSKILGEAMAGIFHNAKNSNLPEF
GDSVSSASKALCGLTEAATQGAYLVGVSDPNSHAGQKGLVDPSQFARAKQSIQMACQNLV
DPACTQSQVLSAATIVAKHTSALCNACRLASSKTSNPVAKRQFVQSAKEVANSTANLVKS
IKALDGAFNQENRLKCKEATGPLIEAVDNLTAFASNPEFASVPAQISPEGLAAMEPIVTA
AKTMLESSTGLIQTARTLAVNPKDPPKWSVLAEHSRTVSDSIKKLITNMREKAPGQRECD
DAIEALNNCIREVDKASLAAISQQLTPRDDISHEALHEQMAASVHEISNLIEPVAIAARS
DASQLGHKVSQMVSYFEPLIMAAIGTASKILNSQQQMSVLDQTKTLAESALQMLYTAKEA
GGNHKVRRHQPNTAVTKSNTNPDELGGLANQLTTEFGDLASEARCAAMTAENDEQAAFHP
EVKRDVQARALRFGSECATGYLGLLEHVLVIIQKPSHDLKQQLAHFSKRVAGSVTELIQA
AEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQIL
EAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAVDDGQWSQGLISAARMVAAATNN
LCEAANSAVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSQTMKRLQVAGNAVKRA
SDNLVKAAQKAAFEAHDDQAVMVKSKMVGGIAQIIAAQEEMLRKERELEEARKRLAMIRQ
QQYKFLPSELREDGQDQ
Download sequence
Identical sequences XP_016114096.1.42290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]