SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016121301.1.42290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016121301.1.42290
Domain Number 1 Region: 40-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000536
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 2 Region: 79-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000307
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 3 Region: 8-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000332
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 116-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000572
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016121301.1.42290
Sequence length 137
Comment PREDICTED: neurogenic locus notch homolog protein 1-like [Sinocyclocheilus grahami]; AA=GCF_001515645.1; RF=representative genome; TAX=75366; STAX=75366; NAME=Sinocyclocheilus grahami; AL=Scaffold; RT=Major
Sequence
MAILLSLSDPCSNGGMCQDRVNAFVCVCLAGFRGERCAEDIDECVSAPCRNRGNCTDCVN
SYTCSCSVGFSGINCEINTPDCTESSCFNGGTCVDGINSFSCACLPGFTGNYCQHDVNEC
DSRPCQNGGTCQDGYAT
Download sequence
Identical sequences XP_016121301.1.42290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]