SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016133257.1.42290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016133257.1.42290
Domain Number 1 Region: 180-249
Classification Level Classification E-value
Superfamily Homeodomain-like 8.55e-18
Family Homeodomain 0.0000577
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.83e-16
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 22-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000951
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016133257.1.42290
Sequence length 359
Comment PREDICTED: insulin gene enhancer protein isl-2a isoform X2 [Sinocyclocheilus grahami]; AA=GCF_001515645.1; RF=representative genome; TAX=75366; STAX=75366; NAME=Sinocyclocheilus grahami; AL=Scaffold; RT=Major
Sequence
MVDILPHPSFLGDMGDHSKKKSGIAMCVGCGSQIHDQYILRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCNTGFCSSDLVMRARDNVYHMECFRCSVC
SRHLLPGDEFSLRDEELLCRADHGLLLERAAAGSPISPGNIHPNRPLHIPEPVPVRQPAH
RNHVHKQSEKTTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTGLSPRVIRVWFQ
NKRCKDKKRSIFMKQLQQQQHSDKTNLQGLTGTPLVAGSPIRHDTTVQGNPVEVQTYQPP
WKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
Download sequence
Identical sequences XP_016133257.1.42290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]