SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016152219.1.66865 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016152219.1.66865
Domain Number 1 Region: 710-761
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000104
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 2 Region: 587-612,661-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000116
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 3 Region: 414-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000119
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 62-112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000459
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 5 Region: 561-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000268
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 6 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000067
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 7 Region: 473-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000679
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016152219.1.66865
Sequence length 994
Comment PREDICTED: zinc finger protein 521 isoform X3 [Ficedula albicollis]; AA=GCF_000247815.1; RF=representative genome; TAX=59894; STAX=59894; NAME=Ficedula albicollis; AL=Chromosome; RT=Major
Sequence
MQVHERNKDGSQSASRMEDWKMKDTQKCSQCEEGFDFPEDLQKHIAECHPECSPNEDRSA
LQCVYCHELFVEETSLVNHMEQAHNGEKKNSCSICSENFHTVEELYSHMDSHQQPESCNH
SNSPSLVTVGYTSVSSTTPDSNLSVDSSTMVETAPPIPKGRGRKRAAQQVPDITGPSSKQ
AKVTYSCIYCNKQLFSSLAVLQIHLKTMHLDKPEQAHICQYCLEVLPSLYNLNEHLKQVH
EAPDPALIVSTMPAMVYQCNFCSEVFNDLNTLQEHIRCSHGFANPAAKDSNAFFCPHCYM
GFLTDSSLEEHIRQVHCDLSSSRFGSPVLGTPKDPVVEVYSCSYCTNSPIFNSVLKLNKH
IKENHKNIPLALNYIHNGKKSRAMSPLSPVTIEQTSLKMMQAVGGAPPRPAGEYICNQCG
AKYTSLDGFQTHLKTHLDTVLPKLTCPQCNKEFPNQESLLKHVTIHFMITSTYYICESCD
KQFTSVDDLQKHLLDMHTFVFFRCTLCQEVFDSKVSIQLHLAVKHSNEKKVYRCTSCNWD
FRNETDLQLHVKHNHLENQGKVHKCIFCGESFGTEVELQCHITTHSKKYNCKFCSKAFHA
IILLEKHLREKHCVFETKTPNCGTNGASEQVQKEEVELQTLLTNSQESHNSHDGSEEDVD
TSEPMYGCDICGAAYTMETLLQNHQLRDHNIRPGESAIVKKKAELIKGNYKCNVCSRTFF
SENGLREHMQTHLGPVKHYMCPICGERFPSLLTLTEHKVTHSKSLDTGNCRICKMPLQSE
EEFLEHCQMHPDLRNSLTGFRCVVCMQTVTSTLELKIHGTFHMQKTGNGSAVQSTGRAQH
LQKLYKCASCLKEFRSKQDLVKLDINGLPYGLCASCVNLSKSGSPSVNIPSSSNRQGMGQ
NENLSSIENKSKAGGLKTRCSSCNVKFESETELQNHIQSIHRELVPDSNSTQLKTPQVSP
MPRISPSQTEESCVPGWAAAGDTGHITAQFWKEP
Download sequence
Identical sequences XP_016152219.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]