SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016155492.1.66865 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016155492.1.66865
Domain Number 1 Region: 108-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.63e-25
Family Clostridium neurotoxins, the second last domain 0.044
Further Details:      
 
Domain Number 2 Region: 534-608,641-659
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000761
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 1414-1488
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000403
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 4 Region: 382-474,564-620
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000537
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 5 Region: 1370-1420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000111
Family Complement control module/SCR domain 0.0064
Further Details:      
 
Domain Number 6 Region: 1479-1537
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000195
Family Complement control module/SCR domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016155492.1.66865
Sequence length 1684
Comment PREDICTED: pappalysin-2 [Ficedula albicollis]; AA=GCF_000247815.1; RF=representative genome; TAX=59894; STAX=59894; NAME=Ficedula albicollis; AL=Chromosome; RT=Major
Sequence
MVYGLEAYVDEKCQALEEGAKGLADILLTLSFCGNPQHSPQTRVMCTPQLLPTFPQCGLN
QPWVMEMEDGGEVEATTGENTDRDTEQKGGERCRGKVGGSGCGGGVPALYFSGGREQLAA
RAEALPAVPRQEFTLELWVKAEGGQNNPAIIAGVFNNCSHSASDKGWALGIRALQLSGKK
DARFFFSLRTDRAATATEVTSHHRYRPGAWTHLAASYDGRWMALYVDGVRVGRSGGQEGP
LHSAFMSSCRTLLLGGDAWGTTHTFRGHLAGLALWHGALSQSQLQRSFLEEVAGETAGLA
LAAGFATPEERWMPFREGAFPQQWVLLSPPPPVVRPLGPPGCGQTACDNVELVSHYNQHW
PLRSWKVVRYRVVNLAEDDGGRPTVSWEQVWRQHRALSEAFRPYNISWQLSLLEVHNSSL
RRRAVLLGCEPSKVGNERCDPECEHPLTGYDGGDCRRPGRCFSWKRRDGVCHMECNNMLD
DFDDGDCCDPRATDVAKTCFDPDSPQRAYMSVKELKEALQLNSTHFLNVYFATSVREELA
GAATWPWDKEALSHLGGVVLNPAYYGMHGHTNTMIHEVGHVLGLYHVFKGVSERESCDDP
CRETTPSMETGDLCADTAPTPKSKLCRDPDPTNDTCGQTHFTGTPFNNYMSYTDDECTNS
FTPNQVARMHCYLDLVYQRWGHSKKPAPIPIPPMITGQTQDSLSIFWLPPISGAIHEREQ
DTLCDSCAEDGTFRQYVHEASSPRVCDSSGYWTPEEAEGPPDVDQPCEPSLQAWSPELHL
YDMNMTVPCPQPDGCILELRFLHPVYPDSLTLWTTYLSMGSPKALSDIEILTEHGESIHL
GPLDTFCDVPFTVKLNIPKKMSGVRIYTFDERMEIDTALLTSRPRSSLCSACRRIQYRLL
RDPPFAEGSPAAPLQAHRRFTDTEVTPGQVYRYQVQVVSHTTSGEASPPLVHMHGAPYCG
DGKVTTSLEEECDDGDLLDGDGCSRKCKKEKGFNCIGEPSLCYIHEEDGVCEPFEKTSSM
LDCGPHTPEGYVDLWAVKAYASQQDAKSCPASLVTGEPVVKACKSHLREVPKDLLQAAWF
PCAPSQENAQDPNEKMLLGDDEGVWLKVCFERPAVPTSLLLFLASSGTVSSQQHKAVVTV
QLTDTDGQNCSLVLTAVPSSPLQDLLPPKLVCWNVGGADVNQKQIPGAGLVTYFFALSTG
MYELSCQHNPIIINVTHSQEDPSPRVASVLFNFSSPLVGIAAVALRTLAQPGSSNPLTTC
LLQHEEGCDHQCYSCAHGACVGPGTCTQPLLLHAATLNCSSDGPGHMACAVSCEKGFVLR
SSGGKRLGSMEQEVVLTCSLGQWDRSVTCDPVDCRVPDQSHVSYAEFSCPVGTTYLQRCF
FSCIPPAKLQGVNQWLTCLEDGLWSLPEAYCKLECDSPPAVANAKLLVPRCLQRNHDVGS
VCRYKCKPGYHVAENAADKPKKKFLKVQCLESGQWEEGHCVPVVCKPPPPVFEGMYNCTQ
GFELDSQCVLNCEQQGQQVPIVCTKEGVWTEEFKLCESLQGTCPSPPELNFVEYKCEQGH
GIGAVCIPSCIIPPSDPVILPRNVTAETMDHRLQPTRVQSIVCTGRLRWYPDPSVIHCIQ
SCEPFQADGWCDTINNRAYCQYDGGDCCSSTLSSRKVIPFAADCDQDECTCRDPAAEENR
RQKQ
Download sequence
Identical sequences XP_016155492.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]