SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016212767.1.69129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016212767.1.69129
Domain Number 1 Region: 369-485,541-566
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000392
Family Regulator of G-protein signaling, RGS 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016212767.1.69129
Sequence length 587
Comment hypothetical protein PV09_05947 [Verruconis gallopava]; AA=GCF_000836295.1; RF=representative genome; TAX=253628; STAX=253628; NAME=Verruconis gallopava; strain=CBS 43764; AL=Scaffold; RT=Major
Sequence
MGSESGITASTKAEPRLDAAAVFYVSFGLAWTIILFGAMFYLWRKRHLPSLAIRGLPLTF
ASVICLHLYWMLVQVCIVIGPIEPEVGEYWVMGTWLPWGISLFYAANAQLLHVAKVQKRF
AHNQNVSESTIMEESTNKSQRSKSWWRTRYQRFMQKSYASRVWILTSIAMIVQFLLTLLM
YLISRKYHASWGIPGTEVHGTAMERKVEQGRGWEWWPGVAVQVFWSWVVAPVVLWRSRHI
RDTHGWRLQTIACCVSGMPATPMWLIALNVPGMEPCNHYFIPPQWIALSIWFIEIFTVFV
PVWEVKKHQGLQEETLDAIAQWESKGQKNVSLSEFSGSTDVVSPMSDSFKKAPSCEIALD
DLFRKSNESSPESLYTMTALNRTLAHDPEPLRIFSALRDFSGENIAFLTSVASWDALWSS
HPSVGSSNSGNGAVIADDLFRRTMFKHAVCIYARFVSQAHADVPVNIVGGHRERLDQVFG
PAAQVLFGEGRGESYSDMPFEYLFGSPAEKQAVHVSSKVNDVVAQRVQWWGDIPDEFDAN
VFRDAERSVKYLVLTNTWPKYVKEMIELRRKESKPIRQQRRGWWFRR
Download sequence
Identical sequences A0A0D2A814
XP_016212767.1.69129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]