SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016235250.1.41232 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016235250.1.41232
Domain Number 1 Region: 9-60,186-268
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.84e-23
Family Regulator of G-protein signaling, RGS 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016235250.1.41232
Sequence length 382
Comment hypothetical protein PV08_07821 [Exophiala spinifera]; AA=GCF_000836115.1; RF=representative genome; TAX=91928; STAX=91928; NAME=Exophiala spinifera; strain=CBS 89968; AL=Scaffold; RT=Major
Sequence
MAHDTSPEQELEQRNRLPTLMEVLGRRTLAPVDLFSFYIYMRDQQRSVDYLDFWLDVSQH
MSLCRHYVRELRRSMLVDTPEMEKATSKRSSALLGDFDLGEGMDTRKSGQESRVSAILRG
DNGTRTKPTSRGRGGSYDHSPAHSMGSSHSRNYSRPSGDRQSLSEQLPQPSYAATEVRTD
SNSPGHSVARADIKASAEKILYTFVLPGSEREIVLPDSMLNKIIRAIEEEGRDDPEVFDD
AKDYVFQAMERDAFPGFLQAKALGNLVPLSVLIRLIIGLSSLMAGFWGGYYMILRNISRS
TRCWLILPFVIGSYFLVSYQYKLDIITAYLGFSEYTWMNWSRVREPFVRRLLLTRATMAF
FMFAAVAVGLSVLFIFVPGTNF
Download sequence
Identical sequences A0A0D2BV01
XP_016235250.1.41232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]