SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016270878.1.102030 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016270878.1.102030
Domain Number 1 Region: 11-58,212-308
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.23e-25
Family Regulator of G-protein signaling, RGS 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016270878.1.102030
Sequence length 424
Comment bud site selection-related protein [Rhodotorula toruloides NP11]; AA=GCF_000320785.1; RF=representative genome; TAX=1130832; STAX=5286; NAME=Rhodotorula toruloides NP11; strain=NP11; AL=Scaffold; RT=Major
Sequence
MTTPATRNPPIVRNRLPSLAEVLRRSTRPPVDLYCFYLFLQREGSEDTLDFWLDVQQHEN
LCRAYFKDLRKSGIAIRDDWPQYERYARTRGSIYGPITGIKRGEPSDDDFERYQQPSSPA
STGEDGEKSHSPYLGVTDDEKDAARYQMRTPSPNPAAGAAPTYPLSPTLRALYPDDDRSS
AEDEGDGSVRRRKHKRHSTVQSRVQPIIARNSAISRTDLIASAERIYSRYLMPGADKEVY
LPPQLRITSFPLSSSTLPAVTHPDYDQQSAAQARIPDMFHAQKEYVYRAMEVDSFPRFLR
AKAFGNLTPISALVRLAIGLVALWAGLATAFAFIFLDAKPKVRRLWIILPFTFAIVNLVA
HSYDLDPLLVFMGLSETTPFRTISIREPYVRKLLFGRALWVTFLSAVIVAVLTVIFWAVP
GHRL
Download sequence
Identical sequences A0A061AEK8 M7X7Z5
XP_016270878.1.102030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]