SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016272803.1.102030 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016272803.1.102030
Domain Number 1 Region: 244-341
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000143
Family UAS domain 0.068
Further Details:      
 
Domain Number 2 Region: 486-565
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000134
Family UBX domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016272803.1.102030
Sequence length 629
Comment ubx domain containing protein [Rhodotorula toruloides NP11]; AA=GCF_000320785.1; RF=representative genome; TAX=1130832; STAX=5286; NAME=Rhodotorula toruloides NP11; strain=NP11; AL=Scaffold; RT=Major
Sequence
MSDDPLASLSPAQRDSFETFNAFTARDSKTPEEARKSVEMLRDAGWDVQMEDGLNALPKY
ARSPALSFSHFEENLSQTAIARVYDEPAGSAASTSRHAYPPTNDAADGVDEALLPGATQR
RHSGTGGLGTGAVGLYYLRQALAVPISIISVPLALLYNFASAIVLFIARIFRLRPATASF
RPRNPFAGAGRPRTTLSPATAAEQWVQSVERTTGLARRGGQDNASAASGVQVGSSSGLSR
RSTVPPPGSGPRLPAFFIGGYDQALRVARDEMRLMMVVLTSEENERDERFKREVLTSEEV
NQVLEEENVMVWGGDVSDRDAYQVGQTLSYIALPFVAFVSLQPSAPPGVSTNPSTASTAS
PRLRLISRLEPTPSNPLTAASLHAHIMTSVLPRAKPFLARLKTQKAQREADRRAREDAER
RVLENARRDEERVLAVRRREEVRKRAELAERERREREAKEREEKERVAALARQWRSWKRG
ELARKGEPAADQPGAVRVAVRLGSGKRVMRTFAAADGTEEVYAWVECELEEGEEGAGEAA
TPPAGYQQRYHFRLATTFPRQVIPLPSHLASPSTANLTGSASATITVGEAFNGLGKTVNL
VVDGLQERRRMSMSSREDEDSEEELEEED
Download sequence
Identical sequences M7XD22
XP_016272803.1.102030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]