SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016279312.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016279312.1.35504
Domain Number 1 Region: 265-407
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-39
Family Third domain of FERM 0.00049
Further Details:      
 
Domain Number 2 Region: 163-267
Classification Level Classification E-value
Superfamily Second domain of FERM 2.36e-33
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 81-160
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-25
Family First domain of FERM 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016279312.1.35504
Sequence length 896
Comment PREDICTED: band 4.1-like protein 4B isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MLSFLRRTFGRRSMQRYGRGAAGRAAGRLGDERDGGTRGATSAPLPAAPGGSIFPPGGGP
VLTGGAAVHIPAAGAGKAALYCRVFLLDGTEVSVDLPKHAKGQDLFDQIVYHLDLVETDY
FGLQFLDSSQVTHWLDHSKPIKKQMKIGSAYVLHFRIKYYSSEPNNLREEFTRYLFVLQL
RHDILSGKLKCPYETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQ
KWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVKGRDGCEYALGLTPTGILIFEGANKI
GLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFRLDSSRTCKHLWKCAVEHHAFF
RLRTPANNKSNRSDFIRLGSRFRFSGRTEYQATHGARLRRTSTFERRPSKRYPSRRHSTF
KANNPVKAAQLCSKNNPEVHNYQIQYHPNIHPGQPQWHPHSPNISYPLPSPVLNNSNLLL
FNIEENGGTPFTTKAPGRHHHHHHHHQHQHQHQHQHQHQHQHQHHSNYGIPVPLESKEMS
TGIPTPSKLSPGHPILYNETAAHLKKMEMETSKVASPWPALHININKVEEKKVPEKSLQF
PLLPLPVPDQLKCNILKAQIETASKASAQVVKEEPDFANVNKKSTLQDPNVRSPVPSIKV
EATPTATEKQEKQEIKPPRVRKLTRQYSFNHSDEDDLPPALVAAIATTASGPPASPASQK
ISTPQKSEGQNQLSPRAKSPSDTGDVFTLGPGDLLMDFTEATPMAESSSAINPAHSRCYP
QISIQMKEEKNEACMGPPIKTRLIKTFPADTSNPFLDPFTTAPQLIADFGESKLQCKAGQ
SSPLTPKATMRPLAETVSTVQTIFARKPISLPDSAETLRQELEREKMMKRLLMTEL
Download sequence
Identical sequences F7EFR2
ENSMODP00000004034 ENSMODP00000004034 XP_016279312.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]