SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016279783.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016279783.1.35504
Domain Number 1 Region: 59-518
Classification Level Classification E-value
Superfamily Sema domain 3.53e-118
Family Sema domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1686-1813,2001-2187
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.41e-46
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 1151-1246
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000446
Family Other IPT/TIG domains 0.0082
Further Details:      
 
Domain Number 4 Region: 1243-1335
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000713
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 5 Region: 521-572
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000654
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1332-1377,1411-1464
Classification Level Classification E-value
Superfamily E set domains 0.0000000000271
Family E-set domains of sugar-utilizing enzymes 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016279783.1.35504
Sequence length 2220
Comment PREDICTED: plexin-B1 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MPFVWESLGDLIHTGHAAVCLLCVLYQVTMLILGSALLQLLWAVCAPASTMQQTTLASFT
PNSTRLQHLVRDPTSGTLYLGATNFLFQLSSELKLEAAVSTGPVLDSRDCLPPVLPLECP
QAQPTDNPNQLLLVSPGGPGRDEGALVVCGSAHQGVCEQRRLDHIGQLLLRPERPGDTQY
VAANDPAISTVGLVGQGPAGEPLLFVGRGYTSRGVGGGIPPITTRALRPPDPQAAFSYEE
TAKLAVGRLSEYSHHFVAAFARRTSVYFLFLRRDLQAQSRAFRPYLSRVCLSDQHYYSYV
ELPLSCGGTPYGLVQAAAVAVPGTGSQGDGGEVLFAAFSSVNPSATGRAPAAGASGASAL
CAFPLDKVDQLANRTRDACYTRDGRAEDGTEIAYIEYDVNSNCAQLPVDTLDAYPCGSDH
TPSPMASRVPLEATPLVEWADVQLTAVAVSVEDGHTIAFLGDSQGQLHKVYLGPEGDHRP
YATQLIQRDSAVSSDLIFDWALEHLYVMTQSTVVRVPVASCSQHLNCTSCLAPKDPYCGW
CVLLGRCSRRAECSRGRGPEPWLWSFSSEPKCLQIQDVSPANVSREEKRNIFLSISDLPV
LRPDESYSCYFEDYESPAVRTDAGVMCPSPDPSRTPALQMDADHVLVPLLLKFGDVVIAS
TEFSFYDCAAVAMLHLSTPCQACVQSTWGCSWCVWQHLCTHKTTCEGGPIVHSQRPPLSA
SWPLLSSVAPTGDVHTFLPSVPPKSSVTPVPKLPPTEPGTPLVALSSPSTDIMPPPTEEA
PRTPPPELGIPLTVPMPTTIAPPTTEAFAFMPSTVGSKVTLSPALEIAPTEEPSHLPSIS
VDSGSMEGVGDIVTLVDVPGAVTELEDLLPPAPSPSPLGDTAVLTSSSWDLGTLALSSSP
HWDQAPSAGPSTTFPGVAGSEEHAPDWLLTEDELPEADEWTGSDASPFSTSTLLSGDGDS
SEFEGPNAPHILLPDLDYQYDSPGLWELEEVINQGPAACPCVEGIEGSSLLPVQIGRELT
LLGRNFHLYQDGLGDYECVLELEGNMEVTEARVECDGVSGTLCRIICQLHQLSYEAPQPE
FHVPVFLRKSGRLRVDSAEGLHVTLYDCSVGRPDCSLCRTADPRYSCVWCDGEHPHCAAR
EACAETEAALCPAPLIHMVEPLTGPVDGGTRITIRGSNLGQKHQDIAETVTVAGVPCAVD
AQEYEVSSSIVCVTGGSGEEKVGHVTVEVPGGGHGISDHKFAYQDPEVRSIFPVRGPKAG
GTCLTLQGSKLLTGRLEDIRVLVGDHPCQLFSVAQMEQLQCQTSPSPVPAALQVAVWFGG
VGRQLQQGLFQYTPDPNITSAGPAKSFVSGGRVIWVHGQNLDVVQTPRIRVTVSTQEQHQ
RQRRGLGRRRRIVPETVTECPPDVPCSTQHFEEPCHINSSHLLVCRTPAIPGLLGGTWVQ
LEFVLDNLLFDFATLHPTRFSYEANPILKPLNMEDPSSPFRHKPGSVLSVEGENLDLAIS
KEEVVAMIGDGPCLVKTLTRNHLYCEPPVEQPPPRHREGLNSLPEFTVQMGNLNFTLGRV
QYDIESPLAFPVGAQVGLGVGASLLALGVLIIVFIYRRKSKQALRDYKKVQIQLENLETS
VRDRCKKEFTDLMTEMTDLTSDLVGSGIPFLDYKSYAERVFFPGHRESPLHRDLGVPESR
RPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYVASLLTVALHGKLEYFTDI
LRTLLSDLVAQYVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIK
HQVDKGPVDSVTGKAKYTLNDNRLLREDLEYRPLTLNAVAVPGVGLAEAPGVPVKVLDCD
TISQAKEKILDQLYKGAPLAQRPDPGALDVEWRSGVAGHLILSDEDVTSVVQGAWRRLNT
LQHYKVPDGATVALVPRFSKHIPRENQDYVPGEKTPMLEDMDEGGIRPWHLVKPSEEPEP
PRQRRGSLRGGDRERAKAIPEIYLTRLLSMKGTLQTFVDDLFQVILSTSRPVPLAIKYFF
DLLDDQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQT
FMDACTLADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTISASDQEMNSALAELS
RNYSGDLSALVALHELYKYINKYYDQIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences XP_016279783.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]