SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016281462.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016281462.1.35504
Domain Number 1 Region: 81-360
Classification Level Classification E-value
Superfamily L domain-like 2.66e-52
Family Ngr ectodomain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 428-497
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000142
Family Fibronectin type III 0.004
Further Details:      
 
Weak hits

Sequence:  XP_016281462.1.35504
Domain Number - Region: 35-78
Classification Level Classification E-value
Superfamily L domain-like 0.000476
Family Ngr ectodomain-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016281462.1.35504
Sequence length 661
Comment PREDICTED: leucine-rich repeat transmembrane protein FLRT2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MGLKTTKWPSHRALLLKSWVIISLGLYMQVSKNMACPNVCRCDRNFVYCNERSLTSVPLG
IPEGVTVLYLHNNQINNAGFPAELHSVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENN
IQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPV
DLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKGIAEGTFSHLSKLKEFSIVRN
SLSHPPPDLPGTHLVKLYLQDNQINHIPLTAFSNLHKLERLDISNNQLRMLAQGVFDNLS
NLKQLTARNNPWFCDCGIKWVTEWLKFIPSSLNVRGFMCQGPEQVRGMAVRELNMNLLSC
PTTTPGFSLMTPPPSVIPPTTQIPTQPAATPSGNSTPLTPTVSKLLPTVPDWDGRERVTP
VVSERILLSVHSVNDTSIQVSWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQDLS
LINLEPKSTYRICLVPLDAFNYRAGEDTVCSEATTHASHLNNGSNSASSHEQTTSHNMGS
PFLLAGLIGGAVIFVLVVLLSIFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSI
LEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCH
T
Download sequence
Identical sequences F7D2R9
ENSMODP00000032688 ENSMODP00000032688 13616.ENSMODP00000032688 XP_007472750.1.35504 XP_016281458.1.35504 XP_016281462.1.35504 XP_016281467.1.35504 XP_016281468.1.35504 XP_016281470.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]