SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016281892.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016281892.1.35504
Domain Number 1 Region: 234-407
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-25
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 518-630
Classification Level Classification E-value
Superfamily Second domain of FERM 6.02e-16
Family Second domain of FERM 0.0033
Further Details:      
 
Weak hits

Sequence:  XP_016281892.1.35504
Domain Number - Region: 422-512
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0403
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016281892.1.35504
Sequence length 736
Comment PREDICTED: krev interaction trapped protein 1 isoform X3 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLLEVPIEGQKKKRKKVLLETKLQG
SGEITQSILDYVVETTKPISPANQGIKGKRVVLMKKFPLDGEKMGREASLFIVPSVVKDN
TKYSYSPGCPVFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYATEPSQTENLLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKEHQWVDDFPLHRSACEGD
SELLNRLLNDSFSVNQLDNDHWAPIHYACWYGKVEATRMLLEKGKCNPNLLNGQLSSPLH
FAAGGGHVEIVQILLNHPEVDRHIIDQQGRSPLNVCEENKQNDWEETAKLLKEAINKPYE
KVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSHETQQYFTIWICSENLSLQLKPYHKP
LQHVRDWPEILNELTNLDPQRETPQLFLRRDVRLPLEVERKIEDPLAILILFDEARYNLL
KGFYTSPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPITKLKSKAPHWTNR
ILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQVFTKASSSSHKVIRVYV
GVNIKGLHLLNMETKTLLISLKYGCFMWQLGDADSCFQIHSLENKMSFIVHTKQAGLVVK
LLLKLNGQLMPSERNE
Download sequence
Identical sequences F7CJW0
ENSMODP00000013369 13616.ENSMODP00000013369 ENSMODP00000013369 XP_001378239.1.35504 XP_007505068.1.35504 XP_007505069.1.35504 XP_016281892.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]