SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016282100.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016282100.1.35504
Domain Number 1 Region: 140-567
Classification Level Classification E-value
Superfamily Sema domain 6.41e-110
Family Sema domain 0.0000962
Further Details:      
 
Domain Number 2 Region: 1471-1598,1787-1973
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-41
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 930-1025
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000382
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 4 Region: 1022-1112
Classification Level Classification E-value
Superfamily E set domains 0.000000000000344
Family Other IPT/TIG domains 0.038
Further Details:      
 
Domain Number 5 Region: 570-617
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000222
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 6 Region: 1109-1154,1198-1250
Classification Level Classification E-value
Superfamily E set domains 0.000000392
Family E-set domains of sugar-utilizing enzymes 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016282100.1.35504
Sequence length 2006
Comment PREDICTED: plexin-B3 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MFSIPEAMKVVAMKCVEVPSLGAPPFLYQDNAYDIHSVPGGSALGQLSGGGPPSASIFLD
PKAGRDPRGLQGDEVLTPKVLKHNSNPSLDYCALGQLGGPVDRMPGEPGVPKMTSLLPTL
FLLLLPLPSRRSWHLALAQHFSAPNTTFNHLAMDAATGMLYVGAVNHLYQLTPDLQQVGE
AVTGPIWDSPDCLPFRDRTECPQARPTDNANQLLLVSGQARELVACGQVRQGVCEKRSLG
NVAQLVFRAEDPGDGQFVAANAPGVATVGLVVSAPGRDLLYVARGLAGKLSAGVPPLTVR
QLAGPQAFSSEGLGRLVVGDFSDYNNSYVGAFAGTQFAYFLFRRRGSRTQADYRSYVARV
CLNDANLYSYVEMPLVCQGYSLVQAAYLAPGQGGGTLLVVASPGPMGGSALCAFPLQEVD
SRMERARRLCYTMGGHSPAGEEATIEYGVTSRCVFLPSDSPDSYPCGDEHTPSPIASHQP
LEAEPLLTSIPHLSAVAALEEAGHTIVFLGDTQGQLHKVFLNGSTGQLYSSLPVGPPGTA
VNPDLLLDRNGSHLYVMTSSQVTKVPISSCQNFPDCPSCLQAQDPFCGWCVLQGRCVRKE
QCAGSEQSHQWLWSYGAPEGSLCLAIQSLVPSQQPRQEQGQVTMVVPRLPVLAPDKYFHC
AFDDYETLAQVDDSQVVCESPPQEQLPPSGEGTDHITVPLALMFEDISVAVTNFSFYDCQ
ATGALDVAAPCSACVRSPWRCHWCPQSASCVSGDSCPDGERTVYHSQEADVLTKGPDFCP
HVEGLATSHLVPVGWETRLALRVRNLHHYQSKAASYHCWLELPGALLGLQASLEEGDGDT
QLIRCQAQQFRPSPPRKELQVPIYVTRGNTHRVDNAGNINVTLYDCTVGHEDCSHCQAAD
KNLSCVWCSQGRPTCSYRPLCPPETVESLCPLPSIHLIKPQTGPPEGGVALTILGSNLGS
RLEDVADAVTVAGQPCRLDPTLYHISTQIVCVTSPALKDTTGPIKVTIKNRPPSVSAQLF
SYQDPVLRNLSPRQGPRAGGTLLTIFGHHLLTESNVRAFLGDEPCHILGPVCPEAIVCRT
GPWATPGEAELLVVFGLAQRRLATGHFSYTPDPQLLSAEPSVGFRGGGRMIRVTGTNLDV
VQRPLLSVWLEEAPAGPQQLDPQQVAEHRCVDGGHPQAAQDTKAWQTCSWLETGLLECST
GCSANSSGLLLCPSPALPGLARLRRMFFTLDNIRVDFVNASGGQDFLYQPDPHLHPLSRD
RPAHPYRLKPGNVLDVEGEGLNLGISKDEVQVQIGKGECVVKTLTLTHLYCEPPMWPPPP
LNSSSALPEFIVHMGNLRLNLGPVKYEVEASLPSFPTEAQIGLGVGVSVLISMVLLLILM
YRRKSKQAMRDYKKVLVQLENLEISVGDQCRKEFTDLMTEMTDLSSDLEGSGIPFLDYKT
FTERVFFPGHHGSPLRSELDVPDARRATVKQGLNQLANLLNSKLFLIKFIHTLEEQPTFS
QRDRCYVASLLSLALHGKLEYLTDIMKTLLNDLTAQYVQKNPKLMLRRTETMVEKLLTNW
MSICLYSFLKEVAGEPLYMLFRAIKYQVDKGPVDAVTGKAKRTLNDSRLLREDVEFWPLT
LTVLVGPGTGTGELQRVPARVLNTDTITQVKEKVLDQVYKGTPFSQRPSVHALDLEWRSG
LAGHLTLSDEDLTSVTQNQWKRLNTLQHYKVPDGATVGLIPRMHNGNGISKSPNQSFLSG
ESLPMLEDGDESGIRLWHLVKCTEEPEVPKQRRSSLRERERAKAIPEIYLTRLLSMKGTL
QKFVDDTFQAILSVDRPVPIAVKYLFDFLDELADKYGIEDQETLHIWKTNSLLLRFWVNT
LKNPQFIFDVRVSDNVDAILTVIAQTFIDSCTISEHKVGRDSPVNKLLYAREIPRYKQMV
EKYYADIRQNTTASYQEMNSALTELSGNYASDITCLVALHELYNYINKYYDQIISALEED
PVGQKMQLAYRLQQIAALVENKVTDL
Download sequence
Identical sequences XP_016282100.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]