SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016288368.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016288368.1.35504
Domain Number 1 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 515-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.75e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 179-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.43e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 459-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 264-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 557-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 10-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-18
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 9 Region: 142-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-17
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 10 Region: 98-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000979
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 366-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000333
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 12 Region: 226-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000726
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016288368.1.35504
Sequence length 613
Comment PREDICTED: zinc finger protein 420-like isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MALERDRLAAQEVVTFKDVAVDFTREEWRLLSPPQKELYKEVMLENAQNLLSVEGEIRPE
MKVNPTEVSCLVEEMELQRFMRGGPDSFATWQFCVGPQNSSHIEHQRMHPEEKSSENNQC
GKTFMHRVSHAGHERIHTSEGHYEYKQCGKTFNESSHLAKHHRIHTGEKPYECDHCGKTF
SRRSILTEHKRIHTGEKPYECKQCGKTFSQRSQLAVHQRIHTGEKPYECNLCGKTFSQRS
KLGVHHRIHTGEEPYECNQCGKRFNKRSNLARHHKIHTGEKSYECNLCGKAFSMSCYLSV
HQRTHTGEKPYECKQCGKAFIMSSYLSVHQRTHTGEKPYECKQCGKTFSRNANLAVHQKI
HTGEKPYECKQCGKVFSMSCYLAVHQRIHTGEKPYECKHCGKAFRVSSSLVTHQRIHTGE
KPYECKQCGKTFSRSTNLAVHQRIHTGEKPYECTQCGKTFSCSSSLATHQRIHTGEKPYE
CKQCGKAFSCSSSLATHQRIHTGVKPYECKQCGKTFSCSSSLAIHQRVHTGEKPYECKQC
GKAFSCSSSLATHQRIHTGEKPYECKQCGKTFSCISSLAAHQRIHNGEKYYECKLCEKTF
SQRSLLAAHQRKH
Download sequence
Identical sequences XP_016288368.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]