SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016309607.1.79318 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016309607.1.79318
Domain Number 1 Region: 37-517
Classification Level Classification E-value
Superfamily Sema domain 2.49e-93
Family Sema domain 0.00061
Further Details:      
 
Domain Number 2 Region: 1384-1507,1673-1829
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.22e-33
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 856-948
Classification Level Classification E-value
Superfamily E set domains 0.000000000000104
Family Other IPT/TIG domains 0.029
Further Details:      
 
Domain Number 4 Region: 946-1039
Classification Level Classification E-value
Superfamily E set domains 0.000000000000204
Family Other IPT/TIG domains 0.06
Further Details:      
 
Domain Number 5 Region: 1039-1116
Classification Level Classification E-value
Superfamily E set domains 0.0000000000789
Family E-set domains of sugar-utilizing enzymes 0.037
Further Details:      
 
Domain Number 6 Region: 520-572
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000192
Family Plexin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016309607.1.79318
Sequence length 1897
Comment PREDICTED: plexin-D1-like [Sinocyclocheilus anshuiensis]; AA=GCF_001515605.1; RF=representative genome; TAX=1608454; STAX=1608454; NAME=Sinocyclocheilus anshuiensis; AL=Scaffold; RT=Major
Sequence
MPPSPADRRSLRLLAAALAVFLTALQARTAGALQIQQAFASPSRTNNFVVDAVSRRVYLA
AVNSLYQLNATLTREVETRTGPVLDNPLCHAPQLPQATCEHQKTLTDNHNKLLTLDRAQG
VLLACGSVFQGFCELRAMDDASRLAVRFPQDGATVFPSMLNIAANHENASTVGLVFRSHG
GAARLLVAATYTGMGSEYFPKNHSKEDLRFENTPEIAIRSLDIADLGRLFTYDINPSEDN
VFKIKQEVKQKNKLSFVRAFVHKSYSYIAINNDANAGVKESQPNSILARICLDTDAPRRS
AESRKLTESYIQMGLQCGSSGNIYSRLLSIYPADISSGAAAGAEPHLFGVFAQAGGRAAV
CAFRVLEVEERIRQGRRNCSSGPNSDVQVLDSVIQGSGAECEHKGAIKLQEEQLNCGAAH
LQHPLALRRPLRARPIYEAPGLSSIAVDNVHNRTVMFLGTSRGRLRKLSLLANLSVANQW
SLKLASNEPVHHIMTFDPSDHNYLYLMTTHHLLRVQVSACGQYSSCSECVSAGDAHCGWC
TLERRCSVQKNCSSGTLSRSWISTGDGVQQCPSMTITPSEISRSAHMRDVGILINGSVPD
LQGLQVECDYGVGITTNATVHLDYSTTQIQTCPLLPLHMYPTIPFGTDHVTVPMAIRVNG
VSVVSGNFTIYECERTGEIHFKTACTSCLSTAWHCYWDPRLNLCVSSKESSPHVLLENSS
FCPRMVADDVPPLPSGSTHVFSLELKNIEHGAELDCDLGDGQLYRAQWLDGLAVKCSGVT
LKTTMWSKKFQLNLRRRGTSTYIDSPEPMTVEVYSCSAGDSDCSQCWGRQTQGHMCVWCD
NSCQQRDQCHAITTRCPDPHIQKVEPLSGPLTGGTLLTVQGRNLGHSATQLNVSIGHVPC
SVLPQYYTVSVRLVCETGASWEQTSDHVTVRVAGNAVGVSKDIFSFVEPRLLEFTPQQGP
LAGGTRLTIHGQFLDAGSTVNIKINRTQNCTIFMLSSDVIKCVMPPAKPAVAENVSVCVV
YDDRPCLSASPSFTFTYEKNPTISHIRPNKSFLSGGRSISVTGYGFNLVQSVRMEVSGVG
QTSCSYVSSTLIVCQSPAANQSQQAMARFYLNEVLYRGEDASPSGRGPDEDEEPHADAFH
FDYVEDPQFYTANKEKLIKHHPGEPLILIINKGPSELDLTLQEYSVTIGSDLCDITFHNE
QLFHCTINRSLSASTGELPVTVRVGHFQKVIAMVQMGGGSELAIVVSIVVCCVLLLLCTV
ALVVYCTKSRRAERYWQKTLLQMEEMESQIRDEIRKGFAELQTDMTDLTKELSRTQGIPF
LEYKQFVTRTFFPKMCSDYERRLVQPMYENDPLGPRALSETHPLLQDWQSSNSVRPNLEE
GITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKELLV
DLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKG
SIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGFGMDSVSVRVMNTDTICQVKDKIL
EAFYKNLPFSQWPREEDVDLEWFPEGRSSRILQDLDNTSVMEDGRKKLNTVFHYQIPDGA
SLAMSMKDKRENTLGRVKDLDTEKYVHLVLPHDELTESRKSHRHSHRKKVLPEIYLTRLL
STKGTLQKFLDDLFQAILSIPPEKPPLAIKYFFDFLEEQADKRGITDPDTLHIWKTNSLP
LRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSLSDLQLGKDSPTNKLLYAKEI
PEYKKRVQCYYKQIQEMAPLSEQEMNAHLAEESRRYRNEFNTNLAVMEVYKYAKRYRNQV
VSALDSSPTARRTQLQHKFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences XP_016309607.1.79318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]