SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016329837.1.79318 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016329837.1.79318
Domain Number 1 Region: 500-636
Classification Level Classification E-value
Superfamily TIMP-like 2.2e-23
Family Netrin-like domain (NTR/C345C module) 0.016
Further Details:      
 
Domain Number 2 Region: 454-507
Classification Level Classification E-value
Superfamily BPTI-like 2.41e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0036
Further Details:      
 
Domain Number 3 Region: 274-370
Classification Level Classification E-value
Superfamily Immunoglobulin 3.76e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 391-448
Classification Level Classification E-value
Superfamily BPTI-like 2.27e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.015
Further Details:      
 
Domain Number 5 Region: 191-241
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000166
Family Ovomucoid domain III-like 0.037
Further Details:      
 
Domain Number 6 Region: 98-152
Classification Level Classification E-value
Superfamily Elafin-like 0.000000034
Family Elafin-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016329837.1.79318
Sequence length 643
Comment PREDICTED: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein-like [Sinocyclocheilus anshuiensis]; AA=GCF_001515605.1; RF=representative genome; TAX=1608454; STAX=1608454; NAME=Sinocyclocheilus anshuiensis; AL=Scaffold; RT=Major
Sequence
MREELHRSPDHGTKATAALLRKSSSMSTSVVPAGFHSQRWSRITRLALLSSLNDVCAVAC
VHKPPAPVDRRTDQRLDVSLMRLSGSPLRLLCSLLLMRLWPVAADHPGVCPNHLNLNLWV
DAQSTCERECQTDQDCAAFEKCCTNVCGLLSCVASRFSDGSSDDGQSGAGVSAGGVASCE
GFVCSHQGAVCDVWEGQPVCKCQDRCESEPSFTCASDGLTYFNRCYMDAEACVQGVTLTV
VTCRYHLSGPNASPLPQDTTAQPTSAAADDSEPFPPTLYSNPQQQVIYLGGTASFHCDVI
GHPKPDITWEKLSEGGERILMRPDQMYGNVVITNIGQLVVYNGQVWDTGIYTCITRNTAG
ALRADYPLSVVRRDSEDFFDDPEAGLPLGQPFSPADCWAPVERGECGEQRVDWYYDAARG
ECHVFAHGGCEGGRNRFETYEECRVSCQREGLGVCSLPAVQGPCKLWEPRWAYNSLMKQC
LAFVYGGCHGNKNNFRTRRECEATCPQPKRRPCKNCRPKGKIVASLCRSDFAIVGRLTEL
IEELDSGIARFHLEQVLRDEKMGLQLFETQHLEVLLAHMDWSCPCPNITQHRELPLLVMG
EVQDGTAVILPHSYVRPISDRRLKKIHEVLGKKTCEMLQRFQD
Download sequence
Identical sequences XP_016329837.1.79318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]